(data stored in ACNUC7421 zone)

EMBL: CP002160.PE278

CP002160.PE278       Location/Qualifiers
FT   CDS             372608..372943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A2701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50069"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM0"
FT                   /inference="similar to AA sequence:KEGG:CLL_A2701"
FT                   /protein_id="ADL50069.1"
FT                   /translation="MSGIKAKKFIIFIIICMLAFTEMTKAIPVSNVFKQGLYIVSEDDQ
FT                   FTGNASLVKADNTTVLTIIDPNGVLKFYKKFDFLNETVNLGIIGYQDAIILVGKGEVYI
FT                   DFEYVNY"
     MSGIKAKKFI IFIIICMLAF TEMTKAIPVS NVFKQGLYIV SEDDQFTGNA SLVKADNTTV        60
     LTIIDPNGVL KFYKKFDFLN ETVNLGIIGY QDAIILVGKG EVYIDFEYVN Y                111
//

If you have problems or comments...

PBIL Back to PBIL home page