(data stored in ACNUC7421 zone)

EMBL: CP002160.PE279

CP002160.PE279       Location/Qualifiers
FT   CDS             373135..373617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0289"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50070"
FT                   /db_xref="GOA:D9SPM1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM1"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADL50070.1"
FT                   /translation="MLEMIIGVRVFILDESERILLVKHSYESEEFWVIPGGGVEAGELT
FT                   RDSGIREVKEETGLDVEIVRLLWTVEEISDKGMSYVNYFLGKIVGGKLALGGDPELSID
FT                   KQVLSDIDFFSREEVKELPVVYPEVLLGGFWDLLEEGTFNQNVWRQRPSVGFGIKE"
     MLEMIIGVRV FILDESERIL LVKHSYESEE FWVIPGGGVE AGELTRDSGI REVKEETGLD        60
     VEIVRLLWTV EEISDKGMSY VNYFLGKIVG GKLALGGDPE LSIDKQVLSD IDFFSREEVK       120
     ELPVVYPEVL LGGFWDLLEE GTFNQNVWRQ RPSVGFGIKE                             160
//

If you have problems or comments...

PBIL Back to PBIL home page