(data stored in ACNUC7421 zone)

EMBL: CP002160.PE28

CP002160.PE28        Location/Qualifiers
FT   CDS             56147..57478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0030"
FT                   /product="Xylan 1,4-beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /note="KEGG: family 43 glycosyl hydrolase; PFAM: glycoside
FT                   hydrolase family 43"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49819"
FT                   /db_xref="GOA:D9SMN4"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN4"
FT                   /inference="protein motif:PRIAM:3.2.1.37"
FT                   /protein_id="ADL49819.1"
FT                   /translation="MPNPYLPLWEYIPDGEPRVFGERIYVYGSHDNAGSDKFCDFKLKV
FT                   WSAPLDDLNNWTCHGHIFHTRDDRDHKSDTPWTDGDLYAPDVVQKDGKYYLYAYIMGAK
FT                   GCVAVSDRPEGPFELLSKYKYEVVEGEGNDSFNGGWFIDPGVLVDDDGRVYVYCGYESS
FT                   FVAEINPDNMYEIIDGTYQKDIIPIEEPFRFFEACSPRKIEDTYYLIYSPRVGSRLVYA
FT                   TSKSPTGPFEYRGVIVDNGVNYPGGNNHGSICNINNQWYIFYHRMTNGTVMSRRACVEK
FT                   IELLSDGTIPEVEMTSLGFENSLSPYKMTPAEIACVLKGGCFITERNLASRPVTAIISG
FT                   CIIGYKYFDFGEDFSTETMKFSAVVKGTGCKAKIKILLDDYENGEEIGVCEIGADDGVY
FT                   TAIVKNVTGRHALYFLVEDSFGGWFTDMFKGRHLFELESFVFMK"
     MPNPYLPLWE YIPDGEPRVF GERIYVYGSH DNAGSDKFCD FKLKVWSAPL DDLNNWTCHG        60
     HIFHTRDDRD HKSDTPWTDG DLYAPDVVQK DGKYYLYAYI MGAKGCVAVS DRPEGPFELL       120
     SKYKYEVVEG EGNDSFNGGW FIDPGVLVDD DGRVYVYCGY ESSFVAEINP DNMYEIIDGT       180
     YQKDIIPIEE PFRFFEACSP RKIEDTYYLI YSPRVGSRLV YATSKSPTGP FEYRGVIVDN       240
     GVNYPGGNNH GSICNINNQW YIFYHRMTNG TVMSRRACVE KIELLSDGTI PEVEMTSLGF       300
     ENSLSPYKMT PAEIACVLKG GCFITERNLA SRPVTAIISG CIIGYKYFDF GEDFSTETMK       360
     FSAVVKGTGC KAKIKILLDD YENGEEIGVC EIGADDGVYT AIVKNVTGRH ALYFLVEDSF       420
     GGWFTDMFKG RHLFELESFV FMK                                               443
//

If you have problems or comments...

PBIL Back to PBIL home page