(data stored in ACNUC7421 zone)

EMBL: CP002160.PE280

CP002160.PE280       Location/Qualifiers
FT   CDS             complement(373658..374479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pjd:Pjdr2_2520 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50071"
FT                   /db_xref="InterPro:IPR025184"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM2"
FT                   /inference="similar to AA sequence:KEGG:Pjdr2_2520"
FT                   /protein_id="ADL50071.1"
FT                   /translation="MTYIPEEAKEIINNNIESLEAVLPDFLESYHIYGSISLGAFNTKE
FT                   SDIDFIAITKRKAMEKDIDILKNLHINIKKKFPKKSLDGMYLFKDDIEALNKKDSPCLR
FT                   FNDGNFEGIVPFLRDSIDAFQLKKYGINIKGQSAKSLDYSVNFNILINNMYENLNTYWL
FT                   NWMNKCKKFPSMDYINLLVNLKEIEWGVLGVSRLYYTFLEKDMTSKVGAGEYALKVFPQ
FT                   RWHKIINESMRLRKGVKTSYYSSLLQRRNDAIAYMDFVIGESNKGLSQNRK"
     MTYIPEEAKE IINNNIESLE AVLPDFLESY HIYGSISLGA FNTKESDIDF IAITKRKAME        60
     KDIDILKNLH INIKKKFPKK SLDGMYLFKD DIEALNKKDS PCLRFNDGNF EGIVPFLRDS       120
     IDAFQLKKYG INIKGQSAKS LDYSVNFNIL INNMYENLNT YWLNWMNKCK KFPSMDYINL       180
     LVNLKEIEWG VLGVSRLYYT FLEKDMTSKV GAGEYALKVF PQRWHKIINE SMRLRKGVKT       240
     SYYSSLLQRR NDAIAYMDFV IGESNKGLSQ NRK                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page