(data stored in ACNUC7421 zone)

EMBL: CP002160.PE281

CP002160.PE281       Location/Qualifiers
FT   CDS             complement(374520..375920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0291"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eel:EUBELI_01889 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50072"
FT                   /db_xref="GOA:D9SPM3"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM3"
FT                   /inference="similar to AA sequence:KEGG:EUBELI_01889"
FT                   /protein_id="ADL50072.1"
FT                   /translation="MDGSMIFISIFSIVIFSIFYAIGSYINALSNKGIFFGVRMPLGYE
FT                   KHENLLALKKDYTKRFNISFLIFVLVYAITIFLFKDYVFSTFFIAIFALLLLIHNNFYT
FT                   IHKKVRQIKKEEVWKFESRKVVVVDLKGRKNTSENKTLSKGLYFILAAIVLVSFIIAFR
FT                   EDIIFLAIAQIVTTLVMLLAIYAINNTKQQLNGGEANELIEKNKRYKYYISLLMYIASL
FT                   AVTLSFFFVILASADFISSPVIFISIIATTFIPMIIIVIGALLIGQGGKNLSVNSVNDE
FT                   DKLIIDRDDDENYVLGCFYYNKNDPAVFVPKRIGIGTDLNYAKPGSKIFIGIVLAILIG
FT                   SLISTFSLSHLVSTGVKEKSITIEANELSIEGMYGIKIPYESIYSIEMMETFPQDMTRK
FT                   NGLAINHTLIGKFKSKAYDNCNLYIMDSRKPNLFIYTKEEKRIFINYENPDRTRELYDK
FT                   IIEKIHNN"
     MDGSMIFISI FSIVIFSIFY AIGSYINALS NKGIFFGVRM PLGYEKHENL LALKKDYTKR        60
     FNISFLIFVL VYAITIFLFK DYVFSTFFIA IFALLLLIHN NFYTIHKKVR QIKKEEVWKF       120
     ESRKVVVVDL KGRKNTSENK TLSKGLYFIL AAIVLVSFII AFREDIIFLA IAQIVTTLVM       180
     LLAIYAINNT KQQLNGGEAN ELIEKNKRYK YYISLLMYIA SLAVTLSFFF VILASADFIS       240
     SPVIFISIIA TTFIPMIIIV IGALLIGQGG KNLSVNSVND EDKLIIDRDD DENYVLGCFY       300
     YNKNDPAVFV PKRIGIGTDL NYAKPGSKIF IGIVLAILIG SLISTFSLSH LVSTGVKEKS       360
     ITIEANELSI EGMYGIKIPY ESIYSIEMME TFPQDMTRKN GLAINHTLIG KFKSKAYDNC       420
     NLYIMDSRKP NLFIYTKEEK RIFINYENPD RTRELYDKII EKIHNN                      466
//

If you have problems or comments...

PBIL Back to PBIL home page