(data stored in ACNUC7421 zone)

EMBL: CP002160.PE283

CP002160.PE283       Location/Qualifiers
FT   CDS             complement(376576..377187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0293"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: cac:CAC2827
FT                   S-adenosylmethionine-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50074"
FT                   /db_xref="GOA:D9SPM5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM5"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ADL50074.1"
FT                   /translation="MSFDQRAKTWDNDRRIKLAKIIATEIGNSLATNKELSAMEFGCGT
FT                   GLISFNLYDKFKKITLIDSSKGMIDVLNAKIDEYKVSNMESLHLDITDENSLDIKFDVI
FT                   YTSMVLHHIENTSSIINTFYKLLNEDGYLCIVDLDEEDGSFHKGHDDFHGHNGFNQEKL
FT                   KDILIDAGFKAVESKTFYHGEKIVEDEKIDYSLFLMKSRK"
     MSFDQRAKTW DNDRRIKLAK IIATEIGNSL ATNKELSAME FGCGTGLISF NLYDKFKKIT        60
     LIDSSKGMID VLNAKIDEYK VSNMESLHLD ITDENSLDIK FDVIYTSMVL HHIENTSSII       120
     NTFYKLLNED GYLCIVDLDE EDGSFHKGHD DFHGHNGFNQ EKLKDILIDA GFKAVESKTF       180
     YHGEKIVEDE KIDYSLFLMK SRK                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page