(data stored in ACNUC7421 zone)

EMBL: CP002160.PE287

CP002160.PE287       Location/Qualifiers
FT   CDS             complement(381877..382308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0297"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ere:EUBREC_1609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50078"
FT                   /db_xref="GOA:D9SPM9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017255"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPM9"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50078.1"
FT                   /translation="MEIKLMSIEDYHKVHELWTNTQGMGMRSLDDSFEGIKKFLKRNPN
FT                   TNFIAKEGDKIVGVLLCGHDGRRAYIYHTAVNVDYRNKGIGKSLVNAVLDALRKEEITK
FT                   VALVAFAENTVGNKFWESVGFINRYDLIYRNFSINTNNT"
     MEIKLMSIED YHKVHELWTN TQGMGMRSLD DSFEGIKKFL KRNPNTNFIA KEGDKIVGVL        60
     LCGHDGRRAY IYHTAVNVDY RNKGIGKSLV NAVLDALRKE EITKVALVAF AENTVGNKFW       120
     ESVGFINRYD LIYRNFSINT NNT                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page