(data stored in ACNUC7421 zone)

EMBL: CP002160.PE289

CP002160.PE289       Location/Qualifiers
FT   CDS             383352..384113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0299"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cac:CAC0373 ABC transporter, ATP binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50080"
FT                   /db_xref="GOA:D9SPN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50080.1"
FT                   /translation="MLVLSVDNLKKVYTSKNNENSTNALNGVDFKIEEGEFVGIMGPSG
FT                   SGKTTLLNLLSGIDRLSSGKIEILGKDVKKMSKNNMTLFRREHLGFVFQDFNLLDSLTI
FT                   EENIMLPLSLDYHEPEEMKGKIDGVMAMLDIATIKDKYPYSVSGGQQQRAAIGRAIINN
FT                   PDIIFADEPTGNLDWKSSNTVMGYFEKLNMMNNNTILVVTHDPFTASYCNRIIFIKDGL
FT                   IHSEVTRDSKERTQFLNVILEKLNSIGDEKK"
     MLVLSVDNLK KVYTSKNNEN STNALNGVDF KIEEGEFVGI MGPSGSGKTT LLNLLSGIDR        60
     LSSGKIEILG KDVKKMSKNN MTLFRREHLG FVFQDFNLLD SLTIEENIML PLSLDYHEPE       120
     EMKGKIDGVM AMLDIATIKD KYPYSVSGGQ QQRAAIGRAI INNPDIIFAD EPTGNLDWKS       180
     SNTVMGYFEK LNMMNNNTIL VVTHDPFTAS YCNRIIFIKD GLIHSEVTRD SKERTQFLNV       240
     ILEKLNSIGD EKK                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page