(data stored in ACNUC7421 zone)

EMBL: CP002160.PE29

CP002160.PE29        Location/Qualifiers
FT   CDS             57755..60652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0031"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   Carbohydrate binding family 6; KEGG: bha:BH1908 glucan
FT                   1,4-beta-glucosidase; SMART: cellulose binding type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49820"
FT                   /db_xref="GOA:D9SMN5"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR005084"
FT                   /db_xref="InterPro:IPR006584"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN5"
FT                   /inference="protein motif:PRIAM:3.2.1.21"
FT                   /protein_id="ADL49820.1"
FT                   /translation="MTTERMENNKILYPFRNPNINIEERLDDLISRLTLEEKIHVLPGY
FT                   QAPIERLGIQAYYVGGEGAHGLVRRQGKLTGPTTVFPQPIGLSSTWNPNLMSEIGKVIS
FT                   DEARAYYKKSDKIAGLNIWAPTVDMERDPRWGRTEEAYGEDPYLTGKLSAALTKAERGE
FT                   DPFYLKMVPTLKHFYANNYEKERISCSSSIDPRNKYEYYLKAFKPSIVEGGAQSIMTSY
FT                   NAINGIPGMVNPEIQTILKDQWGLESFTVSDGGAVCQVVDYHKYFVSHAETIASSIKAG
FT                   LDSFTDNPDMVVAAARDAMERGLMTEDDLDKAVRNIFRTRIRLGQLDPEGYDPYDYISD
FT                   EVICSEENSKVALKAAREAMVLLKNENNILPLNKEKLKKVAVIGPLADELLMDWYSGIH
FT                   PYKVTPLEGIKKKLQEVQVTYSDGADIVTLTSLLNNKLIAQYQDNENILYANKTELCDE
FT                   ALFKHIDWGWGSHTLRSKANNKYMSSKRDKEGILAADQEEAFGWFVKELFNFDRDSDNN
FT                   YYLRTWNWENIGVGEDEKLFINTGKPKVEVDKYKFKKSLISSGIEEATSAAKDADVAIV
FT                   VVGNNPVINGKEEVDRKDIILPPSQQELIKAVYETNKNTIVVIVGTYPFAINWEQENIP
FT                   AIMFTASGGQELGTAIADSIFGDYAPAGRLSMTWYKSIEQLPDITDYDIIKGKRTYMYF
FT                   DQEVIYPFGHGLTYPNFEYKDLLIKSKNYTNNDTIEVSCDIINTGNIDSDEVAQLYVSA
FT                   IKSRIVRPIRELKGFERINIKAGEKKTVNFKVKVEDLAIWDVTRNKYCVEAGEYKFEIG
FT                   TSSKDIKLEGNVYIDGEIIPSRDLSLKTRAENYDDYNKVILKNCIKGGTCVSNIDNNSW
FT                   LCYKDVDFSLSYSTFMAQVANDTTKAIIEVRIDSLEGEVIGTLEVPSTGGLQNWIINSC
FT                   EIKNITGIHDVYFTFNVGDRFNGELRISYFQFITG"
     MTTERMENNK ILYPFRNPNI NIEERLDDLI SRLTLEEKIH VLPGYQAPIE RLGIQAYYVG        60
     GEGAHGLVRR QGKLTGPTTV FPQPIGLSST WNPNLMSEIG KVISDEARAY YKKSDKIAGL       120
     NIWAPTVDME RDPRWGRTEE AYGEDPYLTG KLSAALTKAE RGEDPFYLKM VPTLKHFYAN       180
     NYEKERISCS SSIDPRNKYE YYLKAFKPSI VEGGAQSIMT SYNAINGIPG MVNPEIQTIL       240
     KDQWGLESFT VSDGGAVCQV VDYHKYFVSH AETIASSIKA GLDSFTDNPD MVVAAARDAM       300
     ERGLMTEDDL DKAVRNIFRT RIRLGQLDPE GYDPYDYISD EVICSEENSK VALKAAREAM       360
     VLLKNENNIL PLNKEKLKKV AVIGPLADEL LMDWYSGIHP YKVTPLEGIK KKLQEVQVTY       420
     SDGADIVTLT SLLNNKLIAQ YQDNENILYA NKTELCDEAL FKHIDWGWGS HTLRSKANNK       480
     YMSSKRDKEG ILAADQEEAF GWFVKELFNF DRDSDNNYYL RTWNWENIGV GEDEKLFINT       540
     GKPKVEVDKY KFKKSLISSG IEEATSAAKD ADVAIVVVGN NPVINGKEEV DRKDIILPPS       600
     QQELIKAVYE TNKNTIVVIV GTYPFAINWE QENIPAIMFT ASGGQELGTA IADSIFGDYA       660
     PAGRLSMTWY KSIEQLPDIT DYDIIKGKRT YMYFDQEVIY PFGHGLTYPN FEYKDLLIKS       720
     KNYTNNDTIE VSCDIINTGN IDSDEVAQLY VSAIKSRIVR PIRELKGFER INIKAGEKKT       780
     VNFKVKVEDL AIWDVTRNKY CVEAGEYKFE IGTSSKDIKL EGNVYIDGEI IPSRDLSLKT       840
     RAENYDDYNK VILKNCIKGG TCVSNIDNNS WLCYKDVDFS LSYSTFMAQV ANDTTKAIIE       900
     VRIDSLEGEV IGTLEVPSTG GLQNWIINSC EIKNITGIHD VYFTFNVGDR FNGELRISYF       960
     QFITG                                                                   965
//

If you have problems or comments...

PBIL Back to PBIL home page