(data stored in ACNUC7421 zone)

EMBL: CP002160.PE290

CP002160.PE290       Location/Qualifiers
FT   CDS             384110..386026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0300"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cdf:CD1540 ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50081"
FT                   /db_xref="GOA:D9SPN2"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR027022"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN2"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL50081.1"
FT                   /translation="MNFRELSLKMAKVNIRRYAIYFLCSGFITMLVFLYLTMYTNKDFN
FT                   DSSKVNSMISSNLFAPTLALGIFSVVFIVHFHNYFIKSRKKDFSLFMTLGLTNNDIRKI
FT                   IVLENILITAGSILVGLAMGTLFSKIFYCIVLKITDLNIDFSMNLKSYLYTIVFLGSIN
FT                   LIMILKSCVFVPVYQIIELLKAEHRADYNFMDKKIFRILGISLIISSIIIQWVGIINKK
FT                   SFIPIYVNMVISLIGIYLFVANLHFFIDKFLKLFKQKTANNLVWVSNLKYSIGSSKNII
FT                   FLSTLFLTTIVYFMSFSSTGTEILQKNIFISNPYDLAYGEVYNKNKLSEDKLKSILQDN
FT                   NVKIDSIDNLEFITQGAMTIISDERLKESLGIDLTVEKGQYTYLHQINKNDGYLHNNQE
FT                   VKSYKINEITYTCQDKIDKILFNNIPILKNTNYLIFSDEDYLKIKSTSPLKNIGNIKFI
FT                   NFNDWSKTEKVVQALIKELQDYNKKNTKQFFQNEKDDIKVFKPVSKIEDLTLLKESSRF
FT                   LMFILCFVFSLFFMASNLMIHFKLLLEEQREKVKYQKLYKIGFTERDLSSNISKELMVL
FT                   FLVPCFLGIYLGGYYICFKLSSIGFNNSYGIKYSMFTGCIYILLELLFYLAYRRYYIKK
FT                   ILS"
     MNFRELSLKM AKVNIRRYAI YFLCSGFITM LVFLYLTMYT NKDFNDSSKV NSMISSNLFA        60
     PTLALGIFSV VFIVHFHNYF IKSRKKDFSL FMTLGLTNND IRKIIVLENI LITAGSILVG       120
     LAMGTLFSKI FYCIVLKITD LNIDFSMNLK SYLYTIVFLG SINLIMILKS CVFVPVYQII       180
     ELLKAEHRAD YNFMDKKIFR ILGISLIISS IIIQWVGIIN KKSFIPIYVN MVISLIGIYL       240
     FVANLHFFID KFLKLFKQKT ANNLVWVSNL KYSIGSSKNI IFLSTLFLTT IVYFMSFSST       300
     GTEILQKNIF ISNPYDLAYG EVYNKNKLSE DKLKSILQDN NVKIDSIDNL EFITQGAMTI       360
     ISDERLKESL GIDLTVEKGQ YTYLHQINKN DGYLHNNQEV KSYKINEITY TCQDKIDKIL       420
     FNNIPILKNT NYLIFSDEDY LKIKSTSPLK NIGNIKFINF NDWSKTEKVV QALIKELQDY       480
     NKKNTKQFFQ NEKDDIKVFK PVSKIEDLTL LKESSRFLMF ILCFVFSLFF MASNLMIHFK       540
     LLLEEQREKV KYQKLYKIGF TERDLSSNIS KELMVLFLVP CFLGIYLGGY YICFKLSSIG       600
     FNNSYGIKYS MFTGCIYILL ELLFYLAYRR YYIKKILS                               638
//

If you have problems or comments...

PBIL Back to PBIL home page