(data stored in ACNUC7421 zone)

EMBL: CP002160.PE291

CP002160.PE291       Location/Qualifiers
FT   CDS             complement(386811..389618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cby:CLM_0764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50082"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN3"
FT                   /inference="similar to AA sequence:KEGG:CLM_0764"
FT                   /protein_id="ADL50082.1"
FT                   /translation="MLRKIETSLAILIFPLRSLSLYKKDLFLDIALSSNKNNPSNKTVV
FT                   DHLWDNLNLDFKPHNIDEVKLTLQKHYPFIFEHKEFDKSYVMCKYFDTINKLSTSLISH
FT                   RDGKITFKYWNNKNDKEIFGPYDTSQKIIILNSLSRMMPLDIVAINYLLENDMDDIDQL
FT                   DGFYSSIMLADMQLEDTLVSGVAENHLHAGACFNFAISWNIIMNIFFRGDVSYISHMGI
FT                   PSSLVEYVLSAIILRLTLCIFLFGKYSSSCECNKRFEDWISEFNHKTCFPQEDSDGVNN
FT                   ESLKESYFNNSSDEKLIYDFITLLSYGEDISKWIKNKSIISSDETDFSTYKNLWDILIK
FT                   RYSIDMEENSEDFVFDIFHRAQCVKTYGENVFIFYALKYIKEEKSDTMFSQLFLNYLRI
FT                   RTNFFNHIVQNGATVKGLDYFKKYYHKASKSIAYTDTKYYYKTLFRTMFQDNFLKKLEL
FT                   RTSINTKSFRKDLINILSAYKEVIDEDFLHKTNEILDKEYSKIGENAFPLFGLVIHLLK
FT                   EEDIRSEEKCWHLHNKDTQSTAGELYFGILQEKYMSQIQTLVNLRNEIPHLSQFILGLD
FT                   AASGENDTPISVFAPVFDKARGSNGQTLKSKNKDGKLIKNKSLAFTFHAGEDFRHLLSG
FT                   LRRIDEVIEFCKFHAGDRIGHGIALGVDAEYWKRANPVVILPRGEYLDNLLWVWGIYAN
FT                   EKDYDPKINIYLENQIYTYASEVYENMNGITTPMLFKAYENRFRKFEVNERYKTDNYLD
FT                   KPEIFCIRAADADTKIWNADKLNHVYHCKCYLKKLYEPIQVAVTDIDCGMIVKIQEIIR
FT                   KKVATKGIVVEVNPTSNAVIGEMDSLFDHHAYIINSILEDKNTKIMLNVNSDDPTVFNT
FT                   NVSNELAYLYYGLLHKNVCKEVALAWIDKLRDYGIKTSFINHQIRHKEYYQCLVEVLKN
FT                   LGADI"
     MLRKIETSLA ILIFPLRSLS LYKKDLFLDI ALSSNKNNPS NKTVVDHLWD NLNLDFKPHN        60
     IDEVKLTLQK HYPFIFEHKE FDKSYVMCKY FDTINKLSTS LISHRDGKIT FKYWNNKNDK       120
     EIFGPYDTSQ KIIILNSLSR MMPLDIVAIN YLLENDMDDI DQLDGFYSSI MLADMQLEDT       180
     LVSGVAENHL HAGACFNFAI SWNIIMNIFF RGDVSYISHM GIPSSLVEYV LSAIILRLTL       240
     CIFLFGKYSS SCECNKRFED WISEFNHKTC FPQEDSDGVN NESLKESYFN NSSDEKLIYD       300
     FITLLSYGED ISKWIKNKSI ISSDETDFST YKNLWDILIK RYSIDMEENS EDFVFDIFHR       360
     AQCVKTYGEN VFIFYALKYI KEEKSDTMFS QLFLNYLRIR TNFFNHIVQN GATVKGLDYF       420
     KKYYHKASKS IAYTDTKYYY KTLFRTMFQD NFLKKLELRT SINTKSFRKD LINILSAYKE       480
     VIDEDFLHKT NEILDKEYSK IGENAFPLFG LVIHLLKEED IRSEEKCWHL HNKDTQSTAG       540
     ELYFGILQEK YMSQIQTLVN LRNEIPHLSQ FILGLDAASG ENDTPISVFA PVFDKARGSN       600
     GQTLKSKNKD GKLIKNKSLA FTFHAGEDFR HLLSGLRRID EVIEFCKFHA GDRIGHGIAL       660
     GVDAEYWKRA NPVVILPRGE YLDNLLWVWG IYANEKDYDP KINIYLENQI YTYASEVYEN       720
     MNGITTPMLF KAYENRFRKF EVNERYKTDN YLDKPEIFCI RAADADTKIW NADKLNHVYH       780
     CKCYLKKLYE PIQVAVTDID CGMIVKIQEI IRKKVATKGI VVEVNPTSNA VIGEMDSLFD       840
     HHAYIINSIL EDKNTKIMLN VNSDDPTVFN TNVSNELAYL YYGLLHKNVC KEVALAWIDK       900
     LRDYGIKTSF INHQIRHKEY YQCLVEVLKN LGADI                                  935
//

If you have problems or comments...

PBIL Back to PBIL home page