(data stored in ACNUC7421 zone)

EMBL: CP002160.PE294

CP002160.PE294       Location/Qualifiers
FT   CDS             393745..394815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0305"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: esi:Exig_0967
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50085"
FT                   /db_xref="GOA:D9SPN6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPN6"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ADL50085.1"
FT                   /translation="MRTLTIAKRVVKQLVGDKRSLGLLFIAPVFVLFLLNIILNSTIDK
FT                   ANLVLLNSDNMPKQLIEAFEKEANIQLSEEKSDTLEQLKSREIDGVIEFKDNKIIINLE
FT                   GSQTYVTAAVTKSVSTAISQFTKDNLESKPQLKQLGVKPLEKELNFLNGSEDMTSFDGI
FT                   APMMMGFFIFFFVFLLAGVSFLRERISGTLDRLLATPIKRMEIVLGYFFGFGLFVTLQT
FT                   IVIQVFMVYGLKIEIKGNPFIVLLINILLAAGSLALGTLLSAFAKNEFQLFQFIPLIIV
FT                   PQILFSGLFSLREAPIWVLMLSKIFPLTYGARALSSVVLRGEGLSVVVVDIIVLTGYAV
FT                   LFIILNSLALKKYRSL"
     MRTLTIAKRV VKQLVGDKRS LGLLFIAPVF VLFLLNIILN STIDKANLVL LNSDNMPKQL        60
     IEAFEKEANI QLSEEKSDTL EQLKSREIDG VIEFKDNKII INLEGSQTYV TAAVTKSVST       120
     AISQFTKDNL ESKPQLKQLG VKPLEKELNF LNGSEDMTSF DGIAPMMMGF FIFFFVFLLA       180
     GVSFLRERIS GTLDRLLATP IKRMEIVLGY FFGFGLFVTL QTIVIQVFMV YGLKIEIKGN       240
     PFIVLLINIL LAAGSLALGT LLSAFAKNEF QLFQFIPLII VPQILFSGLF SLREAPIWVL       300
     MLSKIFPLTY GARALSSVVL RGEGLSVVVV DIIVLTGYAV LFIILNSLAL KKYRSL           356
//

If you have problems or comments...

PBIL Back to PBIL home page