(data stored in ACNUC7421 zone)

EMBL: CP002160.PE299

CP002160.PE299       Location/Qualifiers
FT   CDS             399469..401259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0310"
FT                   /product="Ig domain protein group 2 domain protein"
FT                   /note="KEGG: cce:Ccel_0108 kelch repeat protein; PFAM: Ig
FT                   domain protein group 2 domain protein; Kelch repeat type
FT                   1-containing protein; SMART: Kelch repeat type 1-containing
FT                   protein; Ig domain protein group 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50090"
FT                   /db_xref="GOA:D9SPP1"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR017096"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP1"
FT                   /inference="protein motif:PFAM:PF02368"
FT                   /protein_id="ADL50090.1"
FT                   /translation="MGLKKELKIKTGIIAVICTLMFIIGSANLISVKAATFATPSNQWV
FT                   PVASMSGTRHWQNSYVINGKIYVMAGHNGSVSIASVESYNPATNTWTVMASMKEPRHYY
FT                   TSVELDGKIYAIGGHNGSKGLASAEVYDPETNTWTSLPNMKEARYYTSAVVCNGKIYVV
FT                   GGHNGSAVLSSIEVYDPATNTWTTSAVMKAARYAHTSVELNGKIYAIGGFDGNYLSSVE
FT                   VYDPVTGIVSLLPSMNNTRHYHESVVLDGKIYSIGGKNANCLASAEVYDPEKNTWTLLP
FT                   NMKDSRWYFDLFTYNGKIYATGGGNAVYISSVEVYDPITNKWSSLPNMLSTRAYHTSVV
FT                   LNDRIYAIGGCNGPALSAVEAYQIYDIQINKGTSALRVGETDTLQVTKIPAEIQVNWTS
FT                   SDPSVATVDDNGKVTAIKAGTASITAKATDGSNYSVTCVVTVTGEPKIDTILKLNKTAI
FT                   SITIGQVEPLLAITNSPSVTWSSANTDVATVDSNGNVIGMQKGTATITATTADSKTATC
FT                   VVTVNAKSRANLIITMTNNNIKTYDLSMEALNIFLNWYDGRANGMGKSYYIFVNPNNGY
FT                   KEYIPYDKIEYFNIEEYEVN"
     MGLKKELKIK TGIIAVICTL MFIIGSANLI SVKAATFATP SNQWVPVASM SGTRHWQNSY        60
     VINGKIYVMA GHNGSVSIAS VESYNPATNT WTVMASMKEP RHYYTSVELD GKIYAIGGHN       120
     GSKGLASAEV YDPETNTWTS LPNMKEARYY TSAVVCNGKI YVVGGHNGSA VLSSIEVYDP       180
     ATNTWTTSAV MKAARYAHTS VELNGKIYAI GGFDGNYLSS VEVYDPVTGI VSLLPSMNNT       240
     RHYHESVVLD GKIYSIGGKN ANCLASAEVY DPEKNTWTLL PNMKDSRWYF DLFTYNGKIY       300
     ATGGGNAVYI SSVEVYDPIT NKWSSLPNML STRAYHTSVV LNDRIYAIGG CNGPALSAVE       360
     AYQIYDIQIN KGTSALRVGE TDTLQVTKIP AEIQVNWTSS DPSVATVDDN GKVTAIKAGT       420
     ASITAKATDG SNYSVTCVVT VTGEPKIDTI LKLNKTAISI TIGQVEPLLA ITNSPSVTWS       480
     SANTDVATVD SNGNVIGMQK GTATITATTA DSKTATCVVT VNAKSRANLI ITMTNNNIKT       540
     YDLSMEALNI FLNWYDGRAN GMGKSYYIFV NPNNGYKEYI PYDKIEYFNI EEYEVN           596
//

If you have problems or comments...

PBIL Back to PBIL home page