(data stored in ACNUC7421 zone)

EMBL: CP002160.PE3

CP002160.PE3         Location/Qualifiers
FT   CDS             2995..3252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0003"
FT                   /product="S4 domain protein YaaA"
FT                   /note="KEGG: cno:NT01CX_0865 S4 domain-containing protein;
FT                   TIGRFAM: S4 domain protein YaaA; PFAM: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49794"
FT                   /db_xref="GOA:D9SMK9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014330"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMK9"
FT                   /inference="protein motif:TFAM:TIGR02988"
FT                   /protein_id="ADL49794.1"
FT                   /translation="MIKIVNKESQHKYAEDIMSEIVIETEFIKLDSFMKLAAIVSSGSE
FT                   AKMIIKSQEVTVNGEIEERRGKKLYKGDVVEFNGESYKVV"
     MIKIVNKESQ HKYAEDIMSE IVIETEFIKL DSFMKLAAIV SSGSEAKMII KSQEVTVNGE        60
     IEERRGKKLY KGDVVEFNGE SYKVV                                              85
//

If you have problems or comments...

PBIL Back to PBIL home page