(data stored in ACNUC7421 zone)

EMBL: CP002160.PE302

CP002160.PE302       Location/Qualifiers
FT   CDS             404006..405142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0313"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: csc:Csac_0642
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50093"
FT                   /db_xref="GOA:D9SPP4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP4"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADL50093.1"
FT                   /translation="MRIINILGLVIVIAINMITPILISKNVERFFRETDLVEETLAKIK
FT                   KQQNFQNLIIIISIFLFAFFFSNFFSKNEFTRFIMMLSPFIFIIIILVYSSIIYHPIYV
FT                   KVRGIETTIKEEVKDTFRAAIVLLLPSFVIVLVKVEFINKVLINQFVNIFISVFIIIGI
FT                   NLIYPYVFYFSLRAEAIKFPNLNDIVLEFLEQHNIKKVKVYQWPAVKGKMANALVGGLI
FT                   IKKIFISDYLIENMEVDELKAILAHEIGHIKKYHLWIKVTLLILAYPIFTFIGYMMDSV
FT                   ELYFSIKIPIPIGITFFVGCLSIYFSIIYMFFSRYQEYKADEYALKSGIEAEILISAFT
FT                   KLAKLNNSLLKVDEKEERIQTHPSFNNRIERLRKLSLK"
     MRIINILGLV IVIAINMITP ILISKNVERF FRETDLVEET LAKIKKQQNF QNLIIIISIF        60
     LFAFFFSNFF SKNEFTRFIM MLSPFIFIII ILVYSSIIYH PIYVKVRGIE TTIKEEVKDT       120
     FRAAIVLLLP SFVIVLVKVE FINKVLINQF VNIFISVFII IGINLIYPYV FYFSLRAEAI       180
     KFPNLNDIVL EFLEQHNIKK VKVYQWPAVK GKMANALVGG LIIKKIFISD YLIENMEVDE       240
     LKAILAHEIG HIKKYHLWIK VTLLILAYPI FTFIGYMMDS VELYFSIKIP IPIGITFFVG       300
     CLSIYFSIIY MFFSRYQEYK ADEYALKSGI EAEILISAFT KLAKLNNSLL KVDEKEERIQ       360
     THPSFNNRIE RLRKLSLK                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page