(data stored in ACNUC7421 zone)

EMBL: CP002160.PE305

CP002160.PE305       Location/Qualifiers
FT   CDS             407292..408998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0316"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: cac:CAC1352 membrane associated chemotaxis
FT                   sensory transducer; PFAM: chemotaxis sensory transducer;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   chemotaxis sensory transducer; histidine kinase HAMP region
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50096"
FT                   /db_xref="GOA:D9SPP7"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP7"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50096.1"
FT                   /translation="MSNGIKEKKTFRISIKQKLMGIFSIIILLMSAEVMLLVYNSMQTK
FT                   NKYENVLEDINTANKIGDQITSVNKELLDVQFGSKKLSEAKYRETIEEIKAESKAILQS
FT                   QGNDNSKISMYQIYKLMDSVSKSIDLTEASINANKKDEAIKNSQNVGDIVTYVKGYSQK
FT                   YVLQAAKNSEILKEQIATEYRKASIVGSILFIFILGIAISSVALLSYSFIKPIEELKNK
FT                   ATEISKNNLMIDKVNVKTKDELYDLAGAFNNMVDNFKSIIHKINDATTNISSTSLELNN
FT                   TSSQNGAVTEEISATSIEIVSSVNMQNEKVMDTVENLNKMFQVSQDINQSSIKILESAN
FT                   NSVAIADEGNKNISEFLSQLEIIKNSANDTSRITDNLNSRAKEMNSIVNTITSIASQTN
FT                   LLALNAAIEAARAGESGRGFGVVAEEIRKLAEESNDSAEKIGKIVENFKFEADNINDKM
FT                   NESITQISIGNDIAENTMKNFKNISEVNNSVERDVHEISIQIKDFIAMINDISNRMNEV
FT                   NDISNSNYRSSSEISEAINQQAESMMSLIDLASELSNLAEGLDGTIKDFKL"
     MSNGIKEKKT FRISIKQKLM GIFSIIILLM SAEVMLLVYN SMQTKNKYEN VLEDINTANK        60
     IGDQITSVNK ELLDVQFGSK KLSEAKYRET IEEIKAESKA ILQSQGNDNS KISMYQIYKL       120
     MDSVSKSIDL TEASINANKK DEAIKNSQNV GDIVTYVKGY SQKYVLQAAK NSEILKEQIA       180
     TEYRKASIVG SILFIFILGI AISSVALLSY SFIKPIEELK NKATEISKNN LMIDKVNVKT       240
     KDELYDLAGA FNNMVDNFKS IIHKINDATT NISSTSLELN NTSSQNGAVT EEISATSIEI       300
     VSSVNMQNEK VMDTVENLNK MFQVSQDINQ SSIKILESAN NSVAIADEGN KNISEFLSQL       360
     EIIKNSANDT SRITDNLNSR AKEMNSIVNT ITSIASQTNL LALNAAIEAA RAGESGRGFG       420
     VVAEEIRKLA EESNDSAEKI GKIVENFKFE ADNINDKMNE SITQISIGND IAENTMKNFK       480
     NISEVNNSVE RDVHEISIQI KDFIAMINDI SNRMNEVNDI SNSNYRSSSE ISEAINQQAE       540
     SMMSLIDLAS ELSNLAEGLD GTIKDFKL                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page