(data stored in ACNUC7421 zone)

EMBL: CP002160.PE306

CP002160.PE306       Location/Qualifiers
FT   CDS             409029..410057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0317"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="KEGG: atu:Atu3137 C4-dicarboxylate-binding protein;
FT                   TIGRFAM: TRAP dicarboxylate transporter, DctP subunit;
FT                   PFAM: Extracellular solute-binding protein, family 7"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50097"
FT                   /db_xref="GOA:D9SPP8"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPP8"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ADL50097.1"
FT                   /translation="MLKKVISISMLMIGILSFSGCSNKTEGNTYIDMIENKNTSVKTLF
FT                   LAESQAPEYPTTKGDYEFARLVKEKTDGRINIQVVTNSELGSEKDTIAQTRMGAIDFTR
FT                   VSATPLSNYSKIMTVLSLPYLYRDEDHLWAVLSSDIGQRAFNDIEKVGLVGLTYYDSGA
FT                   RSFYNNKKEIKSVADLSGLRIRVQESDLMKSLVTSLGATPTAMDPAAVIQALAVGQIDG
FT                   AENNVATYVSSSQYNVAKYYTFDEHSRVPDILVASKTVLEGLSKEDQEIIKQAAIESSD
FT                   FQRKEWKANEDTMYKKMEDAGVKITKLDQAAKEEFKTAVKPVYDKFGADFTDLIKQIEA
FT                   TK"
     MLKKVISISM LMIGILSFSG CSNKTEGNTY IDMIENKNTS VKTLFLAESQ APEYPTTKGD        60
     YEFARLVKEK TDGRINIQVV TNSELGSEKD TIAQTRMGAI DFTRVSATPL SNYSKIMTVL       120
     SLPYLYRDED HLWAVLSSDI GQRAFNDIEK VGLVGLTYYD SGARSFYNNK KEIKSVADLS       180
     GLRIRVQESD LMKSLVTSLG ATPTAMDPAA VIQALAVGQI DGAENNVATY VSSSQYNVAK       240
     YYTFDEHSRV PDILVASKTV LEGLSKEDQE IIKQAAIESS DFQRKEWKAN EDTMYKKMED       300
     AGVKITKLDQ AAKEEFKTAV KPVYDKFGAD FTDLIKQIEA TK                          342
//

If you have problems or comments...

PBIL Back to PBIL home page