(data stored in ACNUC7421 zone)

EMBL: CP002160.PE308

CP002160.PE308       Location/Qualifiers
FT   CDS             411262..411558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0319"
FT                   /product="protein of unknown function DUF1292"
FT                   /note="PFAM: protein of unknown function DUF1292; KEGG:
FT                   sth:STH1993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50099"
FT                   /db_xref="InterPro:IPR009711"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ0"
FT                   /inference="protein motif:PFAM:PF06949"
FT                   /protein_id="ADL50099.1"
FT                   /translation="MEENQIEYELIEKIEIRNRSYAIIAEKGKEDEAFVMRIKEVKGVK
FT                   DLVPVNDDKEFDEVMKKYEEKFIDVDDAGDEEKLIEEDEETITEIDDLAGNER"
     MEENQIEYEL IEKIEIRNRS YAIIAEKGKE DEAFVMRIKE VKGVKDLVPV NDDKEFDEVM        60
     KKYEEKFIDV DDAGDEEKLI EEDEETITEI DDLAGNER                                98
//

If you have problems or comments...

PBIL Back to PBIL home page