(data stored in ACNUC7421 zone)

EMBL: CP002160.PE31

CP002160.PE31        Location/Qualifiers
FT   CDS             63430..64080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0033"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   Ser/Thr and Tyr protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49822"
FT                   /db_xref="GOA:D9SMN7"
FT                   /db_xref="InterPro:IPR026841"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMN7"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ADL49822.1"
FT                   /translation="MEKFKAALKHSWIFFVYAAVGLIYEVVNRPWGEVRNISTALDANI
FT                   PFIKEFIIPYMSWHLFTVGCGIYLLFKDRRNYYKSMYSVIIGLIICYATYIVFQTTVPR
FT                   PTVVGDDILSQFVRKMYSHDKPMNCFPSIHVYTTVLFTYFILITNRLKKYQIAMMVTWA
FT                   VSIVLSTLFVKQHVILDVVGACALVYACVGLVNWFEARNDVKINNTVENEGQV"
     MEKFKAALKH SWIFFVYAAV GLIYEVVNRP WGEVRNISTA LDANIPFIKE FIIPYMSWHL        60
     FTVGCGIYLL FKDRRNYYKS MYSVIIGLII CYATYIVFQT TVPRPTVVGD DILSQFVRKM       120
     YSHDKPMNCF PSIHVYTTVL FTYFILITNR LKKYQIAMMV TWAVSIVLST LFVKQHVILD       180
     VVGACALVYA CVGLVNWFEA RNDVKINNTV ENEGQV                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page