(data stored in ACNUC7421 zone)

EMBL: CP002160.PE310

CP002160.PE310       Location/Qualifiers
FT   CDS             complement(413181..413378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0321"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="KEGG: lsa:LSA1561 cold shock protein CspA family
FT                   protein; PFAM: Cold-shock protein DNA-binding; SMART: Cold
FT                   shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50101"
FT                   /db_xref="GOA:D9SPQ2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ2"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ADL50101.1"
FT                   /translation="MQGNVKWFNGLKGYGFITSDDGSEIFVHYSGISGEGYKSLEEGDK
FT                   VSFETAEHNNKLQAVNVKKI"
     MQGNVKWFNG LKGYGFITSD DGSEIFVHYS GISGEGYKSL EEGDKVSFET AEHNNKLQAV        60
     NVKKI                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page