(data stored in ACNUC7421 zone)

EMBL: CP002160.PE313

CP002160.PE313       Location/Qualifiers
FT   CDS             416129..417274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0324"
FT                   /product="3D domain-containing protein"
FT                   /note="PFAM: 3D domain-containing protein; KEGG:
FT                   cbh:CLC_2685 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50104"
FT                   /db_xref="GOA:D9SPQ5"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ5"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ADL50104.1"
FT                   /translation="MSKSVKAIAALCVTAMLFSTNVQAVQSSEDVQNQINSQQAELNDL
FT                   KKEKDQLLGQIDQYADEIADTMATIDANNKKMDQIQTDIDKAIADIETAEKDEKEAREK
FT                   YYERLRLMYKNNNNMIIEILFSSSSLGDLLEKVKVIQKIGQSTEGILEQLKDKQANTKQ
FT                   RQDELVLENEKLEDTKKQNETYLSEVQAKMDKANGLSKQLQEKEGQKAKEIESSKATLD
FT                   DIKKKEAEAKLQDFENSESPQGGNTVSEGGAGVLTPGPSPTIEQPNLVESGVTSRGTND
FT                   VSYSRKYTMISTAYTAGNPGVGSRTASGLPVSRNPGGYSTVAVDPSVIPLGTKLYISGY
FT                   GYAIAADTGSAIKSKKIDVYFNTLKECYSWGVRYVEVYVLE"
     MSKSVKAIAA LCVTAMLFST NVQAVQSSED VQNQINSQQA ELNDLKKEKD QLLGQIDQYA        60
     DEIADTMATI DANNKKMDQI QTDIDKAIAD IETAEKDEKE AREKYYERLR LMYKNNNNMI       120
     IEILFSSSSL GDLLEKVKVI QKIGQSTEGI LEQLKDKQAN TKQRQDELVL ENEKLEDTKK       180
     QNETYLSEVQ AKMDKANGLS KQLQEKEGQK AKEIESSKAT LDDIKKKEAE AKLQDFENSE       240
     SPQGGNTVSE GGAGVLTPGP SPTIEQPNLV ESGVTSRGTN DVSYSRKYTM ISTAYTAGNP       300
     GVGSRTASGL PVSRNPGGYS TVAVDPSVIP LGTKLYISGY GYAIAADTGS AIKSKKIDVY       360
     FNTLKECYSW GVRYVEVYVL E                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page