(data stored in ACNUC7421 zone)

EMBL: CP002160.PE314

CP002160.PE314       Location/Qualifiers
FT   CDS             417635..418189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0325"
FT                   /product="primase/topoisomerase like protein"
FT                   /note="TIGRFAM: primase/topoisomerase like protein; PFAM:
FT                   TOPRIM domain-containing protein; KEGG: cpr:CPR_2527
FT                   primase-like protein; SMART: Toprim sub domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50105"
FT                   /db_xref="GOA:D9SPQ6"
FT                   /db_xref="InterPro:IPR004466"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR025156"
FT                   /db_xref="InterPro:IPR034141"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPQ6"
FT                   /inference="protein motif:TFAM:TIGR00334"
FT                   /protein_id="ADL50105.1"
FT                   /translation="MIKEIIVVEGRDDVTAVKRAVDAEVISVSGFGINAKVIEKIKEAQ
FT                   KRQGVIVLTDPDFAGEKIRKIISKRIPEVKHAYISRIEGTKDGDIGVENAEPAAIIKAL
FT                   ENAKCEMKEKREEFDIEDLIFFKLTADPDAKVRREALGKELRIGYGNANQLLKRLNNFG
FT                   VTKEEFMVAMNKINEETKNGK"
     MIKEIIVVEG RDDVTAVKRA VDAEVISVSG FGINAKVIEK IKEAQKRQGV IVLTDPDFAG        60
     EKIRKIISKR IPEVKHAYIS RIEGTKDGDI GVENAEPAAI IKALENAKCE MKEKREEFDI       120
     EDLIFFKLTA DPDAKVRREA LGKELRIGYG NANQLLKRLN NFGVTKEEFM VAMNKINEET       180
     KNGK                                                                    184
//

If you have problems or comments...

PBIL Back to PBIL home page