(data stored in ACNUC7421 zone)

EMBL: CP002160.PE318

CP002160.PE318       Location/Qualifiers
FT   CDS             421439..422251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0329"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: cby:CLM_0127 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50109"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR0"
FT                   /inference="similar to AA sequence:KEGG:CLM_0127"
FT                   /protein_id="ADL50109.1"
FT                   /translation="MKRTLKTLMVFIVIIAVVLSGCGTKNTYFDYMKDGNVDKIIIKNA
FT                   RDKGLRFIITDAEKINNLYKVLEVAENTTSKTSLETDYIIELYNAADIVDTLNYVVGIS
FT                   SSEDGNLFNENNSFKVSKRLDEDIFSYLEDIRKPKYFNKVYYESITKVVDTYNRSNSNS
FT                   SVISFNITDDDDVQKFIYSTELKNFTNQMSGKLNVVKDDASMGNLKLTFETIGYKSSTE
FT                   DNALKATFKAKATIKAVDTGIITNYWISNVYSGNSWNYNITTEEPSDF"
     MKRTLKTLMV FIVIIAVVLS GCGTKNTYFD YMKDGNVDKI IIKNARDKGL RFIITDAEKI        60
     NNLYKVLEVA ENTTSKTSLE TDYIIELYNA ADIVDTLNYV VGISSSEDGN LFNENNSFKV       120
     SKRLDEDIFS YLEDIRKPKY FNKVYYESIT KVVDTYNRSN SNSSVISFNI TDDDDVQKFI       180
     YSTELKNFTN QMSGKLNVVK DDASMGNLKL TFETIGYKSS TEDNALKATF KAKATIKAVD       240
     TGIITNYWIS NVYSGNSWNY NITTEEPSDF                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page