(data stored in ACNUC7421 zone)

EMBL: CP002160.PE319

CP002160.PE319       Location/Qualifiers
FT   CDS             422312..423169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0330"
FT                   /product="ATPase-like, ParA/MinD"
FT                   /note="PFAM: ATPase-like, ParA/MinD; ArgK protein; KEGG:
FT                   ctc:CTC00253 MRP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50110"
FT                   /db_xref="GOA:D9SPR1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR1"
FT                   /inference="protein motif:PFAM:PF10609"
FT                   /protein_id="ADL50110.1"
FT                   /translation="MSTCDTCASSSSCKGKNNQESTCGKLMPKYGNIKNIIGVISGKGG
FT                   VGKSTVTGILATKLKKAGYKVGVLDADITGPSMPRFFGINEKRATAFQDPETKAVVLNP
FT                   IETELGIRVMSLNLLIDNEEDPVIWRGPAITGMLNQMYGDTQWGDLDYLLIDMPPGTGD
FT                   VTLTVMQTIPVTSLVVVSTPQDMVSMIVKKVINMAQRLNISILGSVENMSYIICEKCGD
FT                   KTRIFSNKDPIEHAETLGVKFLGELPIDTKLTDSLEQGTAEAYISEEPIYDEIYHGFLT
FT                   AIKN"
     MSTCDTCASS SSCKGKNNQE STCGKLMPKY GNIKNIIGVI SGKGGVGKST VTGILATKLK        60
     KAGYKVGVLD ADITGPSMPR FFGINEKRAT AFQDPETKAV VLNPIETELG IRVMSLNLLI       120
     DNEEDPVIWR GPAITGMLNQ MYGDTQWGDL DYLLIDMPPG TGDVTLTVMQ TIPVTSLVVV       180
     STPQDMVSMI VKKVINMAQR LNISILGSVE NMSYIICEKC GDKTRIFSNK DPIEHAETLG       240
     VKFLGELPID TKLTDSLEQG TAEAYISEEP IYDEIYHGFL TAIKN                       285
//

If you have problems or comments...

PBIL Back to PBIL home page