(data stored in ACNUC7421 zone)

EMBL: CP002160.PE320

CP002160.PE320       Location/Qualifiers
FT   CDS             423260..423448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0331"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A0122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50111"
FT                   /db_xref="GOA:D9SPR2"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR2"
FT                   /inference="similar to AA sequence:KEGG:CLL_A0122"
FT                   /protein_id="ADL50111.1"
FT                   /translation="MEANVDKDTCIGCGLCPSICPEVFDMQDDGKAGVIVDQVPGNAED
FT                   TAKEAEESCPVNAISVS"
     MEANVDKDTC IGCGLCPSIC PEVFDMQDDG KAGVIVDQVP GNAEDTAKEA EESCPVNAIS        60
     VS                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page