(data stored in ACNUC7421 zone)

EMBL: CP002160.PE322

CP002160.PE322       Location/Qualifiers
FT   CDS             complement(424173..425312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0333"
FT                   /product="chorismate mutase"
FT                   /EC_number="4.2.1.51"
FT                   /note="TIGRFAM: chorismate mutase; KEGG: ckr:CKR_0706
FT                   hypothetical protein; PFAM: prephenate dehydratase;
FT                   Chorismate mutase, type II; amino acid-binding ACT domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50113"
FT                   /db_xref="GOA:D9SPR4"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR011279"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR4"
FT                   /inference="protein motif:TFAM:TIGR01805"
FT                   /protein_id="ADL50113.1"
FT                   /translation="MELNELRKQINDIDKNLLELFQKRMDTAIAIGQYKKEHSMQVFDE
FT                   TREKEVIQRAKTAAEDKYQDFVEAFYQNLMALSREIQREVLNESIDLQIETSSDKTAKK
FT                   PTVVFQGVKGSYSDEALSLYYGDNVNTINVQDFEDVFEELKKGTADYGILPVENSSTGS
FT                   IVDVFDLLAKHDCCIVGEQLLKVEQCLLGVKGATAEDIREIYSHPQGFSQSTEFLKKFP
FT                   DCLKTPYYNTAISAKYVSELNDKSKAAIAGKRAASIYGLDILAENINTSNNNYTRFITI
FT                   SKKLLVADTSDKISVMFILPHESGSLYNALTYFARNNLNMLNIESRPMPNKNWEYMFFI
FT                   DFQGNLHDQRVKNALADLSENSIYVKVLGNYKAAINKAL"
     MELNELRKQI NDIDKNLLEL FQKRMDTAIA IGQYKKEHSM QVFDETREKE VIQRAKTAAE        60
     DKYQDFVEAF YQNLMALSRE IQREVLNESI DLQIETSSDK TAKKPTVVFQ GVKGSYSDEA       120
     LSLYYGDNVN TINVQDFEDV FEELKKGTAD YGILPVENSS TGSIVDVFDL LAKHDCCIVG       180
     EQLLKVEQCL LGVKGATAED IREIYSHPQG FSQSTEFLKK FPDCLKTPYY NTAISAKYVS       240
     ELNDKSKAAI AGKRAASIYG LDILAENINT SNNNYTRFIT ISKKLLVADT SDKISVMFIL       300
     PHESGSLYNA LTYFARNNLN MLNIESRPMP NKNWEYMFFI DFQGNLHDQR VKNALADLSE       360
     NSIYVKVLGN YKAAINKAL                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page