(data stored in ACNUC7421 zone)

EMBL: CP002160.PE324

CP002160.PE324       Location/Qualifiers
FT   CDS             complement(426396..427616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0335"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="TIGRFAM: 3-phosphoshikimate
FT                   1-carboxyvinyltransferase; KEGG: ckr:CKR_0704 hypothetical
FT                   protein; PFAM: EPSP synthase (3-phosphoshikimate
FT                   1-carboxyvinyltransferase)"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50115"
FT                   /db_xref="GOA:D9SPR6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR6"
FT                   /inference="protein motif:TFAM:TIGR01356"
FT                   /protein_id="ADL50115.1"
FT                   /translation="MEITINPKKLSGKVMVPPSKSVSHRAIICASLAKGKSLVKNIKYS
FT                   QDIEATLDCMSAMGMTYERYEDSLTINGIDVFNSNGILSMNTRESGSTIRFLIPMALLC
FT                   SETVEVTGSEKLMQRPLKPYFDIFDTKGIKYSYEGNKLKLSGKLTSGTYEIAGDVSSQF
FT                   ISGLLFALPLVEGNSIVKITTALESIGYVDLTLDMLKNFGIEIINNDYKEFIIKGNQSY
FT                   KAMDCTVEGDYSQAAFYEVAKVLGNDIQCLGLNENSSQGDKEILSIVEKVKNNGLNGIK
FT                   IDVKDIPDLVPILTVLGTFCKGTTEIYNAARVRIKESDRLESTTCELRKLGAKITELPD
FT                   SLIIEGTGKLKGGVVDSWNDHRIAMALAIASTICEEPVTITCAESVNKSYPHFWEHFKS
FT                   IGGNINE"
     MEITINPKKL SGKVMVPPSK SVSHRAIICA SLAKGKSLVK NIKYSQDIEA TLDCMSAMGM        60
     TYERYEDSLT INGIDVFNSN GILSMNTRES GSTIRFLIPM ALLCSETVEV TGSEKLMQRP       120
     LKPYFDIFDT KGIKYSYEGN KLKLSGKLTS GTYEIAGDVS SQFISGLLFA LPLVEGNSIV       180
     KITTALESIG YVDLTLDMLK NFGIEIINND YKEFIIKGNQ SYKAMDCTVE GDYSQAAFYE       240
     VAKVLGNDIQ CLGLNENSSQ GDKEILSIVE KVKNNGLNGI KIDVKDIPDL VPILTVLGTF       300
     CKGTTEIYNA ARVRIKESDR LESTTCELRK LGAKITELPD SLIIEGTGKL KGGVVDSWND       360
     HRIAMALAIA STICEEPVTI TCAESVNKSY PHFWEHFKSI GGNINE                      406
//

If you have problems or comments...

PBIL Back to PBIL home page