(data stored in ACNUC7421 zone)

EMBL: CP002160.PE326

CP002160.PE326       Location/Qualifiers
FT   CDS             complement(428882..429895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0337"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="TIGRFAM: phospho-2-dehydro-3-deoxyheptonate
FT                   aldolase; KEGG: cbt:CLH_2894 3-deoxy-7-phosphoheptulonate
FT                   synthase; PFAM: DAHP synthetase I/KDSA"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50117"
FT                   /db_xref="GOA:D9SPR8"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:D9SPR8"
FT                   /inference="protein motif:TFAM:TIGR01361"
FT                   /protein_id="ADL50117.1"
FT                   /translation="MVVVLKPQTSREQMLVLAENLKKLGVNVAITEGVTGYVLGILGDT
FT                   SKIDQERVELFPEVEKVMRVQEPYKKANRKFHPNDTIVDICGRQIGGNKLAIIAGPCSV
FT                   ETPEQITSVANSVKNSGAGLLRGGAFKPRTSPYAFQGLEDEGLELLKVARANTGLPIVT
FT                   EIMSPKYVEIFEEAVDVVQVGARNMQNFDLLKEVGKMSKPILLKRGLANTIEEWLMSAE
FT                   YIMASGNENVILCERGIRTYETYTRNTLDISAIPAIKKLSHLPIIVDPSHAAGRREMVL
FT                   PLSLAAIAAGADGLIVEVHNDPANAKCDGPQSLTPEQFQDLMNRIKPIAESVGREL"
     MVVVLKPQTS REQMLVLAEN LKKLGVNVAI TEGVTGYVLG ILGDTSKIDQ ERVELFPEVE        60
     KVMRVQEPYK KANRKFHPND TIVDICGRQI GGNKLAIIAG PCSVETPEQI TSVANSVKNS       120
     GAGLLRGGAF KPRTSPYAFQ GLEDEGLELL KVARANTGLP IVTEIMSPKY VEIFEEAVDV       180
     VQVGARNMQN FDLLKEVGKM SKPILLKRGL ANTIEEWLMS AEYIMASGNE NVILCERGIR       240
     TYETYTRNTL DISAIPAIKK LSHLPIIVDP SHAAGRREMV LPLSLAAIAA GADGLIVEVH       300
     NDPANAKCDG PQSLTPEQFQ DLMNRIKPIA ESVGREL                                337
//

If you have problems or comments...

PBIL Back to PBIL home page