(data stored in ACNUC7421 zone)

EMBL: CP002160.PE331

CP002160.PE331       Location/Qualifiers
FT   CDS             432364..434811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0342"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: Nucleotidyl transferase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; KEGG: ckl:CKL_0995 glucose-1-phosphate
FT                   nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50122"
FT                   /db_xref="GOA:D9SQ55"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ55"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ADL50122.1"
FT                   /translation="MKAIVMAGGEGTRLRPLTCNIPKPMMPILGKPVMEYAIENLRKIG
FT                   ITQIGVTLQYLPDEVINYFGDGKEFGVNIQYFIEETPLGTAGSVKNAESFLDETFVVIS
FT                   GDALTDIHLEKAIKYHKEKEAMATMILKEVSVPLEYGVVVTDKDGKVNGFLEKPSWSEL
FT                   FSDKANTGIYILEPEIFSFYEQNQKFDFSNDLFPIMLKENKPLMGYVADGYWCDIGSIE
FT                   QYMKCSYDILSGLVDVDINAVEVEDGVWVGKDCTISPKATITPPVYIGNKCRIYEGSKI
FT                   GPFSIIGKNNIISSNCNIKRSIMFDNCYIGTRVELKGTVLCNKVQMESRAAAFEESSIG
FT                   DETLVCSKATIKPGVKIWPEKVVESGSIIKSNLIWGGKHTKSIFGKQGVVGEVNVDITP
FT                   EFVAKLGSAYGSNLSHGAKVAISCNDYGASQMFKYALATGLLSMGIEIFDLKRVTTSMA
FT                   RHTAHLFGADGAIHVMQDREDAQKVTIQFMDENGVNISSSMERKIEGTLLREDFRRVKA
FT                   DELRRIDHYEDCIEYYIRHIINSLDDKLVMEKKYNLVISVREKYVAKAVFKICETLKIG
FT                   IKEYDTPKDIKGLAREVVNSGANMGIYFSDDGEEAVIIDEKGTIIRNSIYEALKAYILL
FT                   KRSNLKVYATPVSSSMALEKIAEMCESKLVRTKTSQKDVFNGFLSGISEGGVSKEEILR
FT                   WYLMSLDSICMFALTLNHLAKYNTTVSALISLIPRYNSKKAETLCPWNKKGKVMRSLIE
FT                   QHEIASIDLIEGIKLNYKNTWALVLPDKEEPLCRIYAESESKEKVDEIIADLTRKIENI
FT                   VYN"
     MKAIVMAGGE GTRLRPLTCN IPKPMMPILG KPVMEYAIEN LRKIGITQIG VTLQYLPDEV        60
     INYFGDGKEF GVNIQYFIEE TPLGTAGSVK NAESFLDETF VVISGDALTD IHLEKAIKYH       120
     KEKEAMATMI LKEVSVPLEY GVVVTDKDGK VNGFLEKPSW SELFSDKANT GIYILEPEIF       180
     SFYEQNQKFD FSNDLFPIML KENKPLMGYV ADGYWCDIGS IEQYMKCSYD ILSGLVDVDI       240
     NAVEVEDGVW VGKDCTISPK ATITPPVYIG NKCRIYEGSK IGPFSIIGKN NIISSNCNIK       300
     RSIMFDNCYI GTRVELKGTV LCNKVQMESR AAAFEESSIG DETLVCSKAT IKPGVKIWPE       360
     KVVESGSIIK SNLIWGGKHT KSIFGKQGVV GEVNVDITPE FVAKLGSAYG SNLSHGAKVA       420
     ISCNDYGASQ MFKYALATGL LSMGIEIFDL KRVTTSMARH TAHLFGADGA IHVMQDREDA       480
     QKVTIQFMDE NGVNISSSME RKIEGTLLRE DFRRVKADEL RRIDHYEDCI EYYIRHIINS       540
     LDDKLVMEKK YNLVISVREK YVAKAVFKIC ETLKIGIKEY DTPKDIKGLA REVVNSGANM       600
     GIYFSDDGEE AVIIDEKGTI IRNSIYEALK AYILLKRSNL KVYATPVSSS MALEKIAEMC       660
     ESKLVRTKTS QKDVFNGFLS GISEGGVSKE EILRWYLMSL DSICMFALTL NHLAKYNTTV       720
     SALISLIPRY NSKKAETLCP WNKKGKVMRS LIEQHEIASI DLIEGIKLNY KNTWALVLPD       780
     KEEPLCRIYA ESESKEKVDE IIADLTRKIE NIVYN                                  815
//

If you have problems or comments...

PBIL Back to PBIL home page