(data stored in ACNUC7421 zone)

EMBL: CP002160.PE332

CP002160.PE332       Location/Qualifiers
FT   CDS             435215..437326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0343"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /EC_number="1.17.4.2"
FT                   /note="TIGRFAM: anaerobic ribonucleoside-triphosphate
FT                   reductase; KEGG: cbe:Cbei_0068 anaerobic ribonucleoside
FT                   triphosphate reductase; PFAM: ATP-cone domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50123"
FT                   /db_xref="GOA:D9SQ56"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ56"
FT                   /inference="protein motif:TFAM:TIGR02487"
FT                   /protein_id="ADL50123.1"
FT                   /translation="MLYVVKRDGRKVKFNSDKITKAIKRSSEELGYDLKESEAIDLTQG
FT                   IITSIEEEDLEEVTVEQIQNFVEKVLTEKGYTNISKSYSAYRNERTRVRELKSDLMKAI
FT                   QLIGVETDRDNANVGNNFSSKLLRIASESNKWHNLSSMPKQLAKAHENGDVYYHDLDSY
FT                   NLTVNCLHIPTKEVLTRGFNTGYGYIRVPKRIESAAELSCILLQSTQNDMFGGQSHPDF
FT                   DNDMSCFVATTREQIRIELSELGITEEKINQVIEKKVKNAVAQAMQGVVYNLNTMHSRA
FT                   GSQVPFSSINLGIPQSEDAALVCQVFLEEYDKGLGNGEQPIFPNIIFRVKNGVNREPQD
FT                   PYYYLFKLACKVAAKRMNPTFMNIDSDFNKEYYDKGYLPATMGCRTYLMSNINGEPGTK
FT                   GRGNIAPTTINLPRIAILAKKDVDKFFELLENRLLLARESLLHRYQVLRNLKIKDLPFV
FT                   AGQGLMKGAEGLGPDDSIEPILRQGSWGIGFIGLAETLVALIGKHHGETEEAGELGFKI
FT                   INYIREFADKYKEVDKLNWSCYATPAEGLSGKFILKDQQVFGKIKGVTDKEYYTNSYHV
FT                   PVGFPVSITDKIKIEAPYHKLCNGGHISYLELDDYPDGETIEDIITYAYKNTNISYLGI
FT                   NFHIKYCRHCGTYLNYGQHKCPNCGSNDIQGISRVTGYLSLDERFGAGKVAERRDRLSH
FT                   GTSVRTYVE"
     MLYVVKRDGR KVKFNSDKIT KAIKRSSEEL GYDLKESEAI DLTQGIITSI EEEDLEEVTV        60
     EQIQNFVEKV LTEKGYTNIS KSYSAYRNER TRVRELKSDL MKAIQLIGVE TDRDNANVGN       120
     NFSSKLLRIA SESNKWHNLS SMPKQLAKAH ENGDVYYHDL DSYNLTVNCL HIPTKEVLTR       180
     GFNTGYGYIR VPKRIESAAE LSCILLQSTQ NDMFGGQSHP DFDNDMSCFV ATTREQIRIE       240
     LSELGITEEK INQVIEKKVK NAVAQAMQGV VYNLNTMHSR AGSQVPFSSI NLGIPQSEDA       300
     ALVCQVFLEE YDKGLGNGEQ PIFPNIIFRV KNGVNREPQD PYYYLFKLAC KVAAKRMNPT       360
     FMNIDSDFNK EYYDKGYLPA TMGCRTYLMS NINGEPGTKG RGNIAPTTIN LPRIAILAKK       420
     DVDKFFELLE NRLLLARESL LHRYQVLRNL KIKDLPFVAG QGLMKGAEGL GPDDSIEPIL       480
     RQGSWGIGFI GLAETLVALI GKHHGETEEA GELGFKIINY IREFADKYKE VDKLNWSCYA       540
     TPAEGLSGKF ILKDQQVFGK IKGVTDKEYY TNSYHVPVGF PVSITDKIKI EAPYHKLCNG       600
     GHISYLELDD YPDGETIEDI ITYAYKNTNI SYLGINFHIK YCRHCGTYLN YGQHKCPNCG       660
     SNDIQGISRV TGYLSLDERF GAGKVAERRD RLSHGTSVRT YVE                         703
//

If you have problems or comments...

PBIL Back to PBIL home page