(data stored in ACNUC7421 zone)

EMBL: CP002160.PE333

CP002160.PE333       Location/Qualifiers
FT   CDS             437343..437840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0344"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: cbf:CLI_0150 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein;
FT                   TIGRFAM: anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein; PFAM: Radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50124"
FT                   /db_xref="GOA:D9SQ57"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ57"
FT                   /inference="protein motif:TFAM:TIGR02491"
FT                   /protein_id="ADL50124.1"
FT                   /translation="MNKLKVGGFLDNSLVNGIGLRSVIFVSGCTHECQGCHNQELQCFS
FT                   YGEEVTIEEIMDRIKKNLGIIRGVTLSGGDPMEQPQNLMQLSKEIKKLNLNIWCYTGYT
FT                   YEEILNDQDKSELLKEIDVLVDGPFILKLKDEGLKYKGSSNQRIIDVKKSIEQDKVVLL
FT                   DI"
     MNKLKVGGFL DNSLVNGIGL RSVIFVSGCT HECQGCHNQE LQCFSYGEEV TIEEIMDRIK        60
     KNLGIIRGVT LSGGDPMEQP QNLMQLSKEI KKLNLNIWCY TGYTYEEILN DQDKSELLKE       120
     IDVLVDGPFI LKLKDEGLKY KGSSNQRIID VKKSIEQDKV VLLDI                       165
//

If you have problems or comments...

PBIL Back to PBIL home page