(data stored in ACNUC7421 zone)

EMBL: CP002160.PE335

CP002160.PE335       Location/Qualifiers
FT   CDS             438617..438973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0346"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="KEGG: ckr:CKR_3318 hypothetical protein; PFAM:
FT                   regulatory protein ArsR; SMART: regulatory protein ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50126"
FT                   /db_xref="GOA:D9SQ59"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ59"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ADL50126.1"
FT                   /translation="MDENFQCQCNEVHSECVECVKSTMLEEKKFINLSELFKMFADPTR
FT                   LKIIYALLKKELCVCDIAEVIEMSQSSVSHQLRVLKALKLVKYRKEGKVVYYSLDDEHV
FT                   NNIFNFGLSHIEHQ"
     MDENFQCQCN EVHSECVECV KSTMLEEKKF INLSELFKMF ADPTRLKIIY ALLKKELCVC        60
     DIAEVIEMSQ SSVSHQLRVL KALKLVKYRK EGKVVYYSLD DEHVNNIFNF GLSHIEHQ         118
//

If you have problems or comments...

PBIL Back to PBIL home page