(data stored in ACNUC7421 zone)

EMBL: CP002160.PE337

CP002160.PE337       Location/Qualifiers
FT   CDS             439894..440961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0348"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG: cbt:CLH_3143
FT                   CAAX amino protease family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50128"
FT                   /db_xref="GOA:D9SQ61"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ61"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ADL50128.1"
FT                   /translation="MYKARKGNLLMLIIAVMGILGSLLIAVVGKLAPQILSFLRSDIGT
FT                   IVLLGITDFVFLGVPIGAYILFKRRPLKEIFRFNKLSVIDAMLVAASAILFLPTVSILG
FT                   TITSIFSNNDVGEMVTSISSMPTLVMLFSVAVLPAIFEELALRGIALSEYRNKSIVTAV
FT                   LMNGLLFSLFHLNIQQSLYTFAMGAIMALIVIYTDSIFSSMVFHFVVNGINVIMAKISI
FT                   FILEHTDPSMMDSTNAKVETNAATIISFAFFGIIAMSFLVGGILVVILIRNRNRDKWVG
FT                   KYPPFRMKPANKWFKKDADLDKKSLNSTDEQSDKEYRRVFRRQKRAQRIVDVTLILNIV
FT                   IYIAYTLIMTEQITL"
     MYKARKGNLL MLIIAVMGIL GSLLIAVVGK LAPQILSFLR SDIGTIVLLG ITDFVFLGVP        60
     IGAYILFKRR PLKEIFRFNK LSVIDAMLVA ASAILFLPTV SILGTITSIF SNNDVGEMVT       120
     SISSMPTLVM LFSVAVLPAI FEELALRGIA LSEYRNKSIV TAVLMNGLLF SLFHLNIQQS       180
     LYTFAMGAIM ALIVIYTDSI FSSMVFHFVV NGINVIMAKI SIFILEHTDP SMMDSTNAKV       240
     ETNAATIISF AFFGIIAMSF LVGGILVVIL IRNRNRDKWV GKYPPFRMKP ANKWFKKDAD       300
     LDKKSLNSTD EQSDKEYRRV FRRQKRAQRI VDVTLILNIV IYIAYTLIMT EQITL            355
//

If you have problems or comments...

PBIL Back to PBIL home page