(data stored in ACNUC7421 zone)

EMBL: CP002160.PE338

CP002160.PE338       Location/Qualifiers
FT   CDS             441605..444712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0349"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="KEGG: cpe:CPE2541 isoleucyl-tRNA synthetase;
FT                   TIGRFAM: isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50129"
FT                   /db_xref="GOA:D9SQ62"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ62"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ADL50129.1"
FT                   /translation="MYKRVDSSKSFVDIERDMAQLWEEKNIIKKSFAANEDGEYFTFYD
FT                   GPPTANGKPHVGHVLTRSIKDLIPRYKVMKGYKVIRKAGWDTHGLPVELEIEKKLGISG
FT                   KSDIEKHGVEDFVKLCKESVFTYVKMWEEMSTKIGYWVDMENPYVTYHNSYIESVWWAL
FT                   RQMWDKELLYKGHKVMPYCPRCGTSLSSHEVAQGYKDVKDLTAFVKFKVKGEENKYILA
FT                   WTTTPWTLPSNVALAINKTYTYVEVKQNDEIYILAKDLLSILKDEYEVVKEFKGEELLG
FT                   TEYEQLLPFYTPEEKAFFVIHGDFVTLSDGTGIVHIAPAYGEDDNIVAKQNNLPTINLV
FT                   TADGKFLPEVTPFQDKFVKNCDADIVKYLEERNQLLKAEKHVHSYPHCWRCDTPLLYYP
FT                   KASWFIKTSSLRDKLLENNDKINWYPDNIRTGRMGKFLENNIDWALSRDRYWGTPLPIW
FT                   ECECGHRHLIGSIDELKTKGIDVPEDIELHKPYIDKVQITCDKCGSAMTRVAEVIDCWF
FT                   DSGSMPFAQLHYPFENKELFEQNFPAQFISEAVDQTRGWFYTLSAISTLIFDRNAFENC
FT                   IVLGHVLDKKGLKMSKSKGNVVAPNDVLDTVGADATRWHFYTSSAPWLPTRFSKEDVAE
FT                   TQRKFLSTLWNVYSFYVLYADLDNFDATKYESHKSDNVMDKWILSKLNTLIKSVEDHLD
FT                   GYRLTQAALELENFVDELSNWYVRRNRARYWTTELTEDKIGAYTTLYKVLVTLSKISAP
FT                   FVPFMTEQIYQSLVVSLDSNAVESVHLCIWPEYDATAINPELEREMDLAYTIVKLGRSA
FT                   RNSANIKNRQPLSEMLVSTKSLPNYYGDIVKEELNIKQIEFGADLSKYVSFEIKPNLPI
FT                   LGKAYGKLIPEIRKEIAARNQMDLAQTISAGKAVTITVGGTDLELNKENLLVTMQGLEG
FT                   FAFAGEGDTGVVLETTITEELREEGFVREILSKIQTMRKESGFEVADKINLYVANNSML
FT                   EEIVKKFASDIMKETLTVNIFYGEAREYVNNKINGEELNIAVEVVK"
     MYKRVDSSKS FVDIERDMAQ LWEEKNIIKK SFAANEDGEY FTFYDGPPTA NGKPHVGHVL        60
     TRSIKDLIPR YKVMKGYKVI RKAGWDTHGL PVELEIEKKL GISGKSDIEK HGVEDFVKLC       120
     KESVFTYVKM WEEMSTKIGY WVDMENPYVT YHNSYIESVW WALRQMWDKE LLYKGHKVMP       180
     YCPRCGTSLS SHEVAQGYKD VKDLTAFVKF KVKGEENKYI LAWTTTPWTL PSNVALAINK       240
     TYTYVEVKQN DEIYILAKDL LSILKDEYEV VKEFKGEELL GTEYEQLLPF YTPEEKAFFV       300
     IHGDFVTLSD GTGIVHIAPA YGEDDNIVAK QNNLPTINLV TADGKFLPEV TPFQDKFVKN       360
     CDADIVKYLE ERNQLLKAEK HVHSYPHCWR CDTPLLYYPK ASWFIKTSSL RDKLLENNDK       420
     INWYPDNIRT GRMGKFLENN IDWALSRDRY WGTPLPIWEC ECGHRHLIGS IDELKTKGID       480
     VPEDIELHKP YIDKVQITCD KCGSAMTRVA EVIDCWFDSG SMPFAQLHYP FENKELFEQN       540
     FPAQFISEAV DQTRGWFYTL SAISTLIFDR NAFENCIVLG HVLDKKGLKM SKSKGNVVAP       600
     NDVLDTVGAD ATRWHFYTSS APWLPTRFSK EDVAETQRKF LSTLWNVYSF YVLYADLDNF       660
     DATKYESHKS DNVMDKWILS KLNTLIKSVE DHLDGYRLTQ AALELENFVD ELSNWYVRRN       720
     RARYWTTELT EDKIGAYTTL YKVLVTLSKI SAPFVPFMTE QIYQSLVVSL DSNAVESVHL       780
     CIWPEYDATA INPELEREMD LAYTIVKLGR SARNSANIKN RQPLSEMLVS TKSLPNYYGD       840
     IVKEELNIKQ IEFGADLSKY VSFEIKPNLP ILGKAYGKLI PEIRKEIAAR NQMDLAQTIS       900
     AGKAVTITVG GTDLELNKEN LLVTMQGLEG FAFAGEGDTG VVLETTITEE LREEGFVREI       960
     LSKIQTMRKE SGFEVADKIN LYVANNSMLE EIVKKFASDI MKETLTVNIF YGEAREYVNN      1020
     KINGEELNIA VEVVK                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page