(data stored in ACNUC7421 zone)

EMBL: CP002160.PE339

CP002160.PE339       Location/Qualifiers
FT   CDS             445486..447075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0350"
FT                   /product="Protein of unknown function DUF2142, membrane"
FT                   /note="PFAM: Protein of unknown function DUF2142, membrane;
FT                   KEGG: cac:CAC0024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50130"
FT                   /db_xref="GOA:D9SQ63"
FT                   /db_xref="InterPro:IPR018674"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ63"
FT                   /inference="protein motif:PFAM:PF09913"
FT                   /protein_id="ADL50130.1"
FT                   /translation="MNKLFQSKFMFTILLVLSTMGILLVNIRNCFKNIGLNKGSLIHTA
FT                   MGKGIMFFLIFIIASSIAILIFLYKQKNDKNIIVKGFISIAMILGMCILFVNPPFQVPD
FT                   EVAHFFKAYEVSLGRPVSMGSEHGNGYYVPKSFMKLYSDSKVEELIKGKDRLNVSDIKD
FT                   SWNVNLDSDDKFFASYDNVATYMPLQYIPQSIGILIGRIFNLGPLVLFYLARLMNFLTY
FT                   IILAAVAIKLIPVGKEILFLIALMPQNISEVASCAPDALINSLCMVFIALCLYYYKRDK
FT                   KLSKKEMALLLIIVMCVSSFKVVYFPLALLTFLLKDKFESKKFAYSYLCATLFLSILIN
FT                   LIWIPYSSAEIGTNFANNMGKSGIDVGAQVKQAITNPIKYMYILFSTIESNFSFYINST
FT                   IGIIGWLNMPMPQYIIITFMFLMFISTIIENDIEIKVNQKIRYIFIVVFLMIILLIFSS
FT                   LYAIWTPVGADIIEGVQGRYFIPIIALLLLSFKTDRLKINVNKFNLYMIGFVLFSCIII
FT                   ITSIVGKYYVIA"
     MNKLFQSKFM FTILLVLSTM GILLVNIRNC FKNIGLNKGS LIHTAMGKGI MFFLIFIIAS        60
     SIAILIFLYK QKNDKNIIVK GFISIAMILG MCILFVNPPF QVPDEVAHFF KAYEVSLGRP       120
     VSMGSEHGNG YYVPKSFMKL YSDSKVEELI KGKDRLNVSD IKDSWNVNLD SDDKFFASYD       180
     NVATYMPLQY IPQSIGILIG RIFNLGPLVL FYLARLMNFL TYIILAAVAI KLIPVGKEIL       240
     FLIALMPQNI SEVASCAPDA LINSLCMVFI ALCLYYYKRD KKLSKKEMAL LLIIVMCVSS       300
     FKVVYFPLAL LTFLLKDKFE SKKFAYSYLC ATLFLSILIN LIWIPYSSAE IGTNFANNMG       360
     KSGIDVGAQV KQAITNPIKY MYILFSTIES NFSFYINSTI GIIGWLNMPM PQYIIITFMF       420
     LMFISTIIEN DIEIKVNQKI RYIFIVVFLM IILLIFSSLY AIWTPVGADI IEGVQGRYFI       480
     PIIALLLLSF KTDRLKINVN KFNLYMIGFV LFSCIIIITS IVGKYYVIA                   529
//

If you have problems or comments...

PBIL Back to PBIL home page