(data stored in ACNUC7421 zone)

EMBL: CP002160.PE34

CP002160.PE34        Location/Qualifiers
FT   CDS             69146..70903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0036"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: cce:Ccel_2453 histidine kinase; PFAM:
FT                   histidine kinase internal region; ATP-binding region ATPase
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase HAMP region domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49825"
FT                   /db_xref="GOA:D9SMP0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMP0"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ADL49825.1"
FT                   /translation="MKSLKIFKKVISNMRIRNRLMAIYVIAGLIPLLLVGTYLTISTRN
FT                   IVRERAVSEAEANSDRIVDRIKEITDLASDVSELLYVDKRLQSLVTTQYNEKDRSLILE
FT                   DYEQYTTITEYMNYYASIDDIILYVKNETVLDWSIVKVTDRIAAQPWYQKTIKNGAKIT
FT                   WQYVYDEYLDKYNLALHRVIKNDNGNEIGVLQIKVTEQPLKNIIQDEPFDTFIILNDEV
FT                   IISNDKRTEDVSIANINYKDNGISYIEYGNEKIVAISRNITSNEINSIKVVSMIPLNKI
FT                   YRQSDLKSATGFAIIFISMAISIIIIFKFSNNFSKRVIVFKGEMHKVVSGDFEIIKTLE
FT                   GDDEIAELYDDLYKMIDSIQLLINQVYVEKIQKEQLASKQKDVEFKMLASQINPHFLYN
FT                   TLETIRMKAYCNEQYEIAEIVKILAKIMRRNLEINDNLVSLESEITMIKNYLKIQKFRF
FT                   GDRITYDINIECNIDDYYVLPLLFQPVVENAFVHGFEHKQGIGEIKIIISKDENRLIFS
FT                   IRDNGVGISPETLENLRASISNINYKGKSIGLNNVNHRIKIYYGDEYGVEIFSGLEVGT
FT                   EVKIYLPIN"
     MKSLKIFKKV ISNMRIRNRL MAIYVIAGLI PLLLVGTYLT ISTRNIVRER AVSEAEANSD        60
     RIVDRIKEIT DLASDVSELL YVDKRLQSLV TTQYNEKDRS LILEDYEQYT TITEYMNYYA       120
     SIDDIILYVK NETVLDWSIV KVTDRIAAQP WYQKTIKNGA KITWQYVYDE YLDKYNLALH       180
     RVIKNDNGNE IGVLQIKVTE QPLKNIIQDE PFDTFIILND EVIISNDKRT EDVSIANINY       240
     KDNGISYIEY GNEKIVAISR NITSNEINSI KVVSMIPLNK IYRQSDLKSA TGFAIIFISM       300
     AISIIIIFKF SNNFSKRVIV FKGEMHKVVS GDFEIIKTLE GDDEIAELYD DLYKMIDSIQ       360
     LLINQVYVEK IQKEQLASKQ KDVEFKMLAS QINPHFLYNT LETIRMKAYC NEQYEIAEIV       420
     KILAKIMRRN LEINDNLVSL ESEITMIKNY LKIQKFRFGD RITYDINIEC NIDDYYVLPL       480
     LFQPVVENAF VHGFEHKQGI GEIKIIISKD ENRLIFSIRD NGVGISPETL ENLRASISNI       540
     NYKGKSIGLN NVNHRIKIYY GDEYGVEIFS GLEVGTEVKI YLPIN                       585
//

If you have problems or comments...

PBIL Back to PBIL home page