(data stored in ACNUC7421 zone)

EMBL: CP002160.PE345

CP002160.PE345       Location/Qualifiers
FT   CDS             450749..454732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0356"
FT                   /product="superfamily I DNA helicase"
FT                   /note="KEGG: cac:CAC3036 superfamily I DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50136"
FT                   /db_xref="GOA:D9SQ69"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ69"
FT                   /inference="similar to AA sequence:KEGG:CAC3036"
FT                   /protein_id="ADL50136.1"
FT                   /translation="MSQKVKNLFNYLINVKGLTDNSIKSIGLKDKNVVLLSNYPKDGIE
FT                   YNPLDEETYIKITKSSGEVYEKIFKIYMSCEREGDNFEIVLGDYIFTWIFQGKKIIYPL
FT                   VTTRMKMIYSKDTEAFTLSVYDNILNLEIDLFRDKELDTKALISIKSRFDLEFLGIQDQ
FT                   FSINSYIKEIISVLDTEGELHEEVYMESEIVTTQNINVYRMPLIMTRKVDNKLLVSEVG
FT                   KILKEIDKGMAIPPSMEAIVEEKVLNDPYKNEFKDIANDLMFPLSSNVEQREIVHRLRD
FT                   NYGVLVQGPPGTGKSHSIANIVCHLLANGKRVLVTSQNAKALKVIISKLPEEIKALCVY
FT                   QLGEDNTLKEIDSSIRRIDEMTSKNPMEYIRKISVLEEKLTSIRENQKLLVKQIKEIEE
FT                   IEYQKIKYNGRVYDISDLARWLASEENENSWIEEEIDLKDKCFITDNEMIRFQHLMDKL
FT                   TREEVENVTLYLENIELIPKKEVFLEYIKKYESLKKREKEFGMMLQSWHVPDNFTIDKD
FT                   IFKVLDLGAYEIKKIKDSWAYKVLGYYNSGSVSRTAIDKIYVLLKCDFTRLLELRIKAA
FT                   DKFIYIPEDIELSKLKFAIKRVKEEVEEKNGLSYGYKFTHRKECKMLAKCTLNNEKICD
FT                   LEGIDSVLDYIEEKLIENNIKHFWNISAKEFNGKEIAKFNLEEMAYLEDALRYIDMIVM
FT                   WEHRYIDKITNCLGDIIPLNKLDWYNEETYIDMKNNLIVLQEYLDYRESKEYILKFKLR
FT                   LSDIEFLSPLRAAIDPFNSIEFNKIYKEFKNYEKLVPFVKEYNIYYNKLKEKLPVTCEK
FT                   LMNAENRSGLKNINKAWMWKQLNALLKRIHDLGIDKLIDACEKENIKEREVIKELAQNK
FT                   AWYQQCLKTTEEKRKSLYCWLQAVKKIGKGRSKFYTKYLSMAQEEMEKCKDIIPAWIMP
FT                   INRVFESLTVNQELFDVVIIDESSQCDLSATTLLMRGKRTIIVGDDNQISPQIIGIDNT
FT                   LVTHYSEAYLKDIPYSRWFDAETNIYTTAQRVFPTRVMLKEHFRCVSEIIGFSNELCYN
FT                   NEIAPLRGREEQGLIPIKTVFVEEGIRESNKSINIKEADTIVDQIYHCCKDEKYKGMTM
FT                   GVISMLGEEQGELIQEKLREKIGEAEIINRKLVCGDAYSFQGDERDIILLSMVVSGDLK
FT                   TRPLTKDVDIKRFNVAASRARNQMWLFHSIDIKNLNPLCVRYKLLNYCQGYQGEKVINQ
FT                   RTGFVQDVYEFLNSKGFKVATLAQNKYGVDFLIEDDKKTIAVQCFGGDLKDIEDQDGME
FT                   NQKIIATMGWKIFKVRESEFYRNPSGLIEKLQKATVEVSGIIA"
     MSQKVKNLFN YLINVKGLTD NSIKSIGLKD KNVVLLSNYP KDGIEYNPLD EETYIKITKS        60
     SGEVYEKIFK IYMSCEREGD NFEIVLGDYI FTWIFQGKKI IYPLVTTRMK MIYSKDTEAF       120
     TLSVYDNILN LEIDLFRDKE LDTKALISIK SRFDLEFLGI QDQFSINSYI KEIISVLDTE       180
     GELHEEVYME SEIVTTQNIN VYRMPLIMTR KVDNKLLVSE VGKILKEIDK GMAIPPSMEA       240
     IVEEKVLNDP YKNEFKDIAN DLMFPLSSNV EQREIVHRLR DNYGVLVQGP PGTGKSHSIA       300
     NIVCHLLANG KRVLVTSQNA KALKVIISKL PEEIKALCVY QLGEDNTLKE IDSSIRRIDE       360
     MTSKNPMEYI RKISVLEEKL TSIRENQKLL VKQIKEIEEI EYQKIKYNGR VYDISDLARW       420
     LASEENENSW IEEEIDLKDK CFITDNEMIR FQHLMDKLTR EEVENVTLYL ENIELIPKKE       480
     VFLEYIKKYE SLKKREKEFG MMLQSWHVPD NFTIDKDIFK VLDLGAYEIK KIKDSWAYKV       540
     LGYYNSGSVS RTAIDKIYVL LKCDFTRLLE LRIKAADKFI YIPEDIELSK LKFAIKRVKE       600
     EVEEKNGLSY GYKFTHRKEC KMLAKCTLNN EKICDLEGID SVLDYIEEKL IENNIKHFWN       660
     ISAKEFNGKE IAKFNLEEMA YLEDALRYID MIVMWEHRYI DKITNCLGDI IPLNKLDWYN       720
     EETYIDMKNN LIVLQEYLDY RESKEYILKF KLRLSDIEFL SPLRAAIDPF NSIEFNKIYK       780
     EFKNYEKLVP FVKEYNIYYN KLKEKLPVTC EKLMNAENRS GLKNINKAWM WKQLNALLKR       840
     IHDLGIDKLI DACEKENIKE REVIKELAQN KAWYQQCLKT TEEKRKSLYC WLQAVKKIGK       900
     GRSKFYTKYL SMAQEEMEKC KDIIPAWIMP INRVFESLTV NQELFDVVII DESSQCDLSA       960
     TTLLMRGKRT IIVGDDNQIS PQIIGIDNTL VTHYSEAYLK DIPYSRWFDA ETNIYTTAQR      1020
     VFPTRVMLKE HFRCVSEIIG FSNELCYNNE IAPLRGREEQ GLIPIKTVFV EEGIRESNKS      1080
     INIKEADTIV DQIYHCCKDE KYKGMTMGVI SMLGEEQGEL IQEKLREKIG EAEIINRKLV      1140
     CGDAYSFQGD ERDIILLSMV VSGDLKTRPL TKDVDIKRFN VAASRARNQM WLFHSIDIKN      1200
     LNPLCVRYKL LNYCQGYQGE KVINQRTGFV QDVYEFLNSK GFKVATLAQN KYGVDFLIED      1260
     DKKTIAVQCF GGDLKDIEDQ DGMENQKIIA TMGWKIFKVR ESEFYRNPSG LIEKLQKATV      1320
     EVSGIIA                                                                1327
//

If you have problems or comments...

PBIL Back to PBIL home page