(data stored in ACNUC7421 zone)

EMBL: CP002160.PE346

CP002160.PE346       Location/Qualifiers
FT   CDS             455002..455697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0357"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   cbo:CBO0392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50137"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ70"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ADL50137.1"
FT                   /translation="MKTIKLDSKVFTYEIKRSKRKTIALRVVSKGTIKISAPLMISVKT
FT                   IEDIIREKTSWILDNAKKQEEIEARFRNRNKILFLGKEYCIEREINKDKTFDFKIDGEI
FT                   FKIIFPRVLEEQEEKELLMRWMKNESRKILKARTDFYCKLLELSYNEIHIKDQKTLWGS
FT                   CSSKDNINYNYRIIMAPIEIVDYLVVHEACHLVHRDHGKAYWNLVGSVIPDYKERRAWL
FT                   KNNGLLLKI"
     MKTIKLDSKV FTYEIKRSKR KTIALRVVSK GTIKISAPLM ISVKTIEDII REKTSWILDN        60
     AKKQEEIEAR FRNRNKILFL GKEYCIEREI NKDKTFDFKI DGEIFKIIFP RVLEEQEEKE       120
     LLMRWMKNES RKILKARTDF YCKLLELSYN EIHIKDQKTL WGSCSSKDNI NYNYRIIMAP       180
     IEIVDYLVVH EACHLVHRDH GKAYWNLVGS VIPDYKERRA WLKNNGLLLK I                231
//

If you have problems or comments...

PBIL Back to PBIL home page