(data stored in ACNUC7421 zone)

EMBL: CP002160.PE347

CP002160.PE347       Location/Qualifiers
FT   CDS             456055..458031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0358"
FT                   /product="excinuclease ABC, B subunit"
FT                   /note="TIGRFAM: excinuclease ABC, B subunit; PFAM: helicase
FT                   domain protein; UvrB/UvrC protein; type III restriction
FT                   protein res subunit; KEGG: cno:NT01CX_1274 excinuclease ABC
FT                   subunit B; SMART: DEAD-like helicase ; helicase domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50138"
FT                   /db_xref="GOA:D9SQ71"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ71"
FT                   /inference="protein motif:TFAM:TIGR00631"
FT                   /protein_id="ADL50138.1"
FT                   /translation="MEEFKIVSEYKPTGDQPQAIESISERVLAGDKFQTLLGVTGSGKT
FT                   FTMANIIEKVQKPTLVLAHNKTLAAQLCSEFREFFPDAAVEYFVSYYDYYQPEAYVAQT
FT                   DTFIEKDASINDEIDRLRHSATAALFERKDVIIVASVSCIYGLGNPDEYRKLSLSLRKG
FT                   MEKDRDEIMRKLIDMQYERNDINFVRATFRVRGDILDIFPASSQKVGIKVEFFGEEIDR
FT                   IREFDVLTGQILRELKHVLIFPASHFASSKETVERSIGKIEAELDERVKELLAEEKLLE
FT                   AQRLKQRTNFDIEMIREMGYCQGIENYSRIMDGRNKGEPPKTLIDFFPEDFLMFIDESH
FT                   VTLPQVRAMYGGDRSRKEALVNYGFRLPCAYDNRPLKFEEFEEKLKQVVFVSATPAKYE
FT                   FDHSTNVAEQIIRPTGLLDPIIEVRPIDGQIDDLYSSIQETIVRGFRILVTTLTKKMAE
FT                   DLTDYLKEMGVKTNYLHSDVTTIDRMKIIKELRMGDFDVLVGINLLREGLDIPEVALVA
FT                   ILDADKEGFLRSNTSLIQTVGRAARNADSKVIMYADKITDSMSYTIKETERRRKIQIDY
FT                   NEAHNITPTTIIKGIRDNIQISTIAEEEAVYLTEETMSQEDLKKKIASLEKEMKAVAKE
FT                   LQFERAAELRDEINKLKTIMNND"
     MEEFKIVSEY KPTGDQPQAI ESISERVLAG DKFQTLLGVT GSGKTFTMAN IIEKVQKPTL        60
     VLAHNKTLAA QLCSEFREFF PDAAVEYFVS YYDYYQPEAY VAQTDTFIEK DASINDEIDR       120
     LRHSATAALF ERKDVIIVAS VSCIYGLGNP DEYRKLSLSL RKGMEKDRDE IMRKLIDMQY       180
     ERNDINFVRA TFRVRGDILD IFPASSQKVG IKVEFFGEEI DRIREFDVLT GQILRELKHV       240
     LIFPASHFAS SKETVERSIG KIEAELDERV KELLAEEKLL EAQRLKQRTN FDIEMIREMG       300
     YCQGIENYSR IMDGRNKGEP PKTLIDFFPE DFLMFIDESH VTLPQVRAMY GGDRSRKEAL       360
     VNYGFRLPCA YDNRPLKFEE FEEKLKQVVF VSATPAKYEF DHSTNVAEQI IRPTGLLDPI       420
     IEVRPIDGQI DDLYSSIQET IVRGFRILVT TLTKKMAEDL TDYLKEMGVK TNYLHSDVTT       480
     IDRMKIIKEL RMGDFDVLVG INLLREGLDI PEVALVAILD ADKEGFLRSN TSLIQTVGRA       540
     ARNADSKVIM YADKITDSMS YTIKETERRR KIQIDYNEAH NITPTTIIKG IRDNIQISTI       600
     AEEEAVYLTE ETMSQEDLKK KIASLEKEMK AVAKELQFER AAELRDEINK LKTIMNND         658
//

If you have problems or comments...

PBIL Back to PBIL home page