(data stored in ACNUC7421 zone)

EMBL: CP002160.PE348

CP002160.PE348       Location/Qualifiers
FT   CDS             458219..461038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0359"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: cac:CAC0503 excinuclease ABC
FT                   subunit A; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50139"
FT                   /db_xref="GOA:D9SQ72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ72"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ADL50139.1"
FT                   /translation="MQDKIIVKGAKVHNLKDVSVTIPRDKFVVFTGLSGSGKSSLAFDT
FT                   IYAEGQRRYVESLSSYARQFLGQMNKPDVEYIEGLSPAISIDQKTTGRNPRSTVGTVTE
FT                   IYDFLRLLYARVGIPHCPKCGREITKQTVDTMVDKIMSLEERTKIQVMAPIIRGKKGEH
FT                   VKVLENIKKNGFVRARIDGELYELEDEEIKLEKTKKHNIEAVIDRLVIKEGIEARLTES
FT                   IETSLKLAEGRVLIDVIDGEEMLFSEHFACPECNISIDEIEPRFFSFNAPFGKCDTCDG
FT                   LGTLMEIDEDLILPNKELSIMQGAVAPWGEGRLKEDSWGFSVLTALSKRYEFDLNTPIK
FT                   DLPREVVEALLYGTNGEKLTIYYANGYKDQYNYAFEGVVNELRRRYMETGSDTIKTEIE
FT                   NYMSDNPCPKCKGARLKPEVLSVTINGRNIYEFCNMPIREELAFMQGLELTEKEKIISN
FT                   QILKEINERLKFLIDVGLDYLSLSRSARTLSGGESQRIRLATQIGSSLVGVLYILDEPS
FT                   IGLHQRDNDKLIATMKHLRDIGNTLIVVEHDEDTIREADFIVDIGPRAGEHGGEIVIAG
FT                   TLDEVKDCKESITGQYLNGEKRIEVPAERRKGNGNSIVVTGGRENNLKNVTAEFKLGMF
FT                   TAVTGVSGSGKSTLVNEILYKGINKQLNRAKINPGQHKDIKGIENIDKIINIDQSPIGR
FT                   TPRSNPATYTGMFDLIRELYASTNEAKMRGYKQGRFSFNVKGGRCEACKGDGIIKIEMQ
FT                   FLSDVYVPCEVCKGKRYNRETLEVKYKGKNIDDVLNMTVEEALEFFENHQRIKTKLETL
FT                   MDVGLGYVRLGQPSTQLSGGEAQRIKLAYELSRRSTGKTLYILDEPTTGLHTADVKKLI
FT                   SILQRLVDGGNTVIVIEHNLDVIKCVDNIIDLGPEGGVRGGTILCTGTPEEVAENKGSY
FT                   TGHYLKRML"
     MQDKIIVKGA KVHNLKDVSV TIPRDKFVVF TGLSGSGKSS LAFDTIYAEG QRRYVESLSS        60
     YARQFLGQMN KPDVEYIEGL SPAISIDQKT TGRNPRSTVG TVTEIYDFLR LLYARVGIPH       120
     CPKCGREITK QTVDTMVDKI MSLEERTKIQ VMAPIIRGKK GEHVKVLENI KKNGFVRARI       180
     DGELYELEDE EIKLEKTKKH NIEAVIDRLV IKEGIEARLT ESIETSLKLA EGRVLIDVID       240
     GEEMLFSEHF ACPECNISID EIEPRFFSFN APFGKCDTCD GLGTLMEIDE DLILPNKELS       300
     IMQGAVAPWG EGRLKEDSWG FSVLTALSKR YEFDLNTPIK DLPREVVEAL LYGTNGEKLT       360
     IYYANGYKDQ YNYAFEGVVN ELRRRYMETG SDTIKTEIEN YMSDNPCPKC KGARLKPEVL       420
     SVTINGRNIY EFCNMPIREE LAFMQGLELT EKEKIISNQI LKEINERLKF LIDVGLDYLS       480
     LSRSARTLSG GESQRIRLAT QIGSSLVGVL YILDEPSIGL HQRDNDKLIA TMKHLRDIGN       540
     TLIVVEHDED TIREADFIVD IGPRAGEHGG EIVIAGTLDE VKDCKESITG QYLNGEKRIE       600
     VPAERRKGNG NSIVVTGGRE NNLKNVTAEF KLGMFTAVTG VSGSGKSTLV NEILYKGINK       660
     QLNRAKINPG QHKDIKGIEN IDKIINIDQS PIGRTPRSNP ATYTGMFDLI RELYASTNEA       720
     KMRGYKQGRF SFNVKGGRCE ACKGDGIIKI EMQFLSDVYV PCEVCKGKRY NRETLEVKYK       780
     GKNIDDVLNM TVEEALEFFE NHQRIKTKLE TLMDVGLGYV RLGQPSTQLS GGEAQRIKLA       840
     YELSRRSTGK TLYILDEPTT GLHTADVKKL ISILQRLVDG GNTVIVIEHN LDVIKCVDNI       900
     IDLGPEGGVR GGTILCTGTP EEVAENKGSY TGHYLKRML                              939
//

If you have problems or comments...

PBIL Back to PBIL home page