(data stored in ACNUC7421 zone)

EMBL: CP002160.PE349

CP002160.PE349       Location/Qualifiers
FT   CDS             461540..463609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0360"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="KEGG: cth:Cthe_1235 cellulose
FT                   1,4-beta-cellobiosidase; PFAM: Fibronectin type III domain
FT                   protein; SMART: Fibronectin type III domain protein; Ig
FT                   domain protein group 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50140"
FT                   /db_xref="GOA:D9SQ73"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ73"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ADL50140.1"
FT                   /translation="MKIKILSKKVKMFLGLIVLVMLININANAITFNYDIKNKVIEIES
FT                   DNGLNIKYKYDQDNRIKEISYGDFKIKYKYDQYGRLSEIRYDDGSRIIYEYDKYGRLIG
FT                   TRIIPGHVTLVGISVEKQVYDMDINKTTNIKVIGKYSNGSSRDITNYSTFIVANNNIVT
FT                   IQNVGIITAKAYGETDLKISYLDKTCTVKINVINRGTPRKPNAPTGLIAEKVTQNTVNL
FT                   KWNPAADSLGVAGYDIYSGSNLVGSTNGTSFSINGLENNKEYTFKVRIKDVNGNLSDFS
FT                   EEISVKTLNVVTLLDISVEKEVYDMDINETMNIKVTGKYSDGSSKDITNDAIFTTTNEN
FT                   IITVPNQGTIVTKTYGETDLKISYLDKTYIVKINVTDTTEPSEPEALVAEDITQTTVNL
FT                   KWAPSTDNAGLAGYDIYLGNNLVGSTDNISFLVNGLEPDKEYTFKVLAKDVNGNLSDFS
FT                   EEISVKTLSVVTLLDISVEKEVYDMDINETMNIKVTGKYSDGSSKDITNDAIFTTTNEN
FT                   IIAVPNQGTIVTKNYGETALNIGYLDKTYTVKIRVVDKIIPSSPNNLVAESITEKTVNL
FT                   RWSPPIDNVDVVGYDIYLGSDIIGSADSTSFIVKGLESNKEYIFKVRARDVNGNLSELS
FT                   EEIKVKTLIDFTLADLSKRYNMSKNQPEWEEKYDLNNDGIIDIYDIAILCRTLG"
     MKIKILSKKV KMFLGLIVLV MLININANAI TFNYDIKNKV IEIESDNGLN IKYKYDQDNR        60
     IKEISYGDFK IKYKYDQYGR LSEIRYDDGS RIIYEYDKYG RLIGTRIIPG HVTLVGISVE       120
     KQVYDMDINK TTNIKVIGKY SNGSSRDITN YSTFIVANNN IVTIQNVGII TAKAYGETDL       180
     KISYLDKTCT VKINVINRGT PRKPNAPTGL IAEKVTQNTV NLKWNPAADS LGVAGYDIYS       240
     GSNLVGSTNG TSFSINGLEN NKEYTFKVRI KDVNGNLSDF SEEISVKTLN VVTLLDISVE       300
     KEVYDMDINE TMNIKVTGKY SDGSSKDITN DAIFTTTNEN IITVPNQGTI VTKTYGETDL       360
     KISYLDKTYI VKINVTDTTE PSEPEALVAE DITQTTVNLK WAPSTDNAGL AGYDIYLGNN       420
     LVGSTDNISF LVNGLEPDKE YTFKVLAKDV NGNLSDFSEE ISVKTLSVVT LLDISVEKEV       480
     YDMDINETMN IKVTGKYSDG SSKDITNDAI FTTTNENIIA VPNQGTIVTK NYGETALNIG       540
     YLDKTYTVKI RVVDKIIPSS PNNLVAESIT EKTVNLRWSP PIDNVDVVGY DIYLGSDIIG       600
     SADSTSFIVK GLESNKEYIF KVRARDVNGN LSELSEEIKV KTLIDFTLAD LSKRYNMSKN       660
     QPEWEEKYDL NNDGIIDIYD IAILCRTLG                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page