(data stored in ACNUC7421 zone)

EMBL: CP002160.PE351

CP002160.PE351       Location/Qualifiers
FT   CDS             464904..465839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0362"
FT                   /product="NlpA lipoprotein"
FT                   /note="KEGG: cth:Cthe_2802 NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50142"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ75"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2802"
FT                   /protein_id="ADL50142.1"
FT                   /translation="MKNFKRSISLIIITMLVLSIVGCGKEKKSETSVKIGYLPITHAIP
FT                   LYIENEVAKGDIELVKFGSWAELMDALNSGKIDGASVLIELAMKAKAQGVDLKAVALGH
FT                   TDGNAVVVSDEINTAKDIKGKNFAIPNKVSTHNILLYEMLKKENIKINEVNIVELPPSE
FT                   MAVALQEKRIDGYCVAEPFGAKSVVNGNGKVLKQSSEILKNSICCSLVLRGDFIEKNKA
FT                   KASEVVSKYVEASKYIEENEVDTRSKAKEFLSVKEDVLDVSLQWISFKKLKIEEADYNS
FT                   IVGYIKEMNLFDNPPTYEEFIDNSLLEEVK"
     MKNFKRSISL IIITMLVLSI VGCGKEKKSE TSVKIGYLPI THAIPLYIEN EVAKGDIELV        60
     KFGSWAELMD ALNSGKIDGA SVLIELAMKA KAQGVDLKAV ALGHTDGNAV VVSDEINTAK       120
     DIKGKNFAIP NKVSTHNILL YEMLKKENIK INEVNIVELP PSEMAVALQE KRIDGYCVAE       180
     PFGAKSVVNG NGKVLKQSSE ILKNSICCSL VLRGDFIEKN KAKASEVVSK YVEASKYIEE       240
     NEVDTRSKAK EFLSVKEDVL DVSLQWISFK KLKIEEADYN SIVGYIKEMN LFDNPPTYEE       300
     FIDNSLLEEV K                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page