(data stored in ACNUC7421 zone)

EMBL: CP002160.PE354

CP002160.PE354       Location/Qualifiers
FT   CDS             467586..469613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0365"
FT                   /product="carbon-monoxide dehydrogenase, catalytic subunit"
FT                   /EC_number="1.2.99.2"
FT                   /note="TIGRFAM: carbon-monoxide dehydrogenase, catalytic
FT                   subunit; KEGG: cth:Cthe_2801 carbon-monoxide dehydrogenase,
FT                   catalytic subunit; PFAM: Prismane"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50145"
FT                   /db_xref="GOA:D9SQ78"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ78"
FT                   /inference="protein motif:TFAM:TIGR01702"
FT                   /protein_id="ADL50145.1"
FT                   /translation="MEAIIGKVKYHHQIINGEGNSHNNNNHGGSEVNDYLQAVSEYRKT
FT                   FASKQDVLDNTPDPAVREMLLHMEQIGCDTTFDRFDQQKPQCSFGLAGSCCRICYMGPC
FT                   KITPKSPKGICGADADLIVARNILRGMAGGVAGHGIHAREVLLALKNAAEGKLNLPILG
FT                   EDKVKKTAVQFGLETEGKTVNELASQIADILLEDLSRTVPGTFRAIEANAPEERKKVWK
FT                   EMDIIPIGAYHEAFEALHRTGAATDGDWENVMKQFLRCGLAFVWSGVVGSAIGTDSLFG
FT                   IGNRSTSKVNVGALKKGYVNIAVHGHLPVLVSEIVKQGRSEEFIKLAKENGAEGIQFYG
FT                   VCCSGLSAMYRYNDVIPLSNAIGAELVLGTGALDLWVADVQDVYPSIMDVARCYKTTVV
FT                   TTSDSARLPGAEHYGYDHQHSNIGETEALAKKIITRAIESFADRRDVPVFIPSYEVDAE
FT                   IGFSLEYIQNRFGGVKPVLDAMKSGKILGIVNLVGCNNPRVVYEKTVVDIADILIKNNV
FT                   LVLTNGCASFPLLKLGFCNTSALAKTGEGLRSFLESDLPPVWHMGECIDNARASGLFTT
FT                   LAKEAGELIKDMPFALSSPEWSNEKGIGAALGFRLLGINSYHCVHAPVHGSEKVMNFLY
FT                   TGTKDTLGSTMNVEVDHIKLAEMILQDLREKRVALGWDKE"
     MEAIIGKVKY HHQIINGEGN SHNNNNHGGS EVNDYLQAVS EYRKTFASKQ DVLDNTPDPA        60
     VREMLLHMEQ IGCDTTFDRF DQQKPQCSFG LAGSCCRICY MGPCKITPKS PKGICGADAD       120
     LIVARNILRG MAGGVAGHGI HAREVLLALK NAAEGKLNLP ILGEDKVKKT AVQFGLETEG       180
     KTVNELASQI ADILLEDLSR TVPGTFRAIE ANAPEERKKV WKEMDIIPIG AYHEAFEALH       240
     RTGAATDGDW ENVMKQFLRC GLAFVWSGVV GSAIGTDSLF GIGNRSTSKV NVGALKKGYV       300
     NIAVHGHLPV LVSEIVKQGR SEEFIKLAKE NGAEGIQFYG VCCSGLSAMY RYNDVIPLSN       360
     AIGAELVLGT GALDLWVADV QDVYPSIMDV ARCYKTTVVT TSDSARLPGA EHYGYDHQHS       420
     NIGETEALAK KIITRAIESF ADRRDVPVFI PSYEVDAEIG FSLEYIQNRF GGVKPVLDAM       480
     KSGKILGIVN LVGCNNPRVV YEKTVVDIAD ILIKNNVLVL TNGCASFPLL KLGFCNTSAL       540
     AKTGEGLRSF LESDLPPVWH MGECIDNARA SGLFTTLAKE AGELIKDMPF ALSSPEWSNE       600
     KGIGAALGFR LLGINSYHCV HAPVHGSEKV MNFLYTGTKD TLGSTMNVEV DHIKLAEMIL       660
     QDLREKRVAL GWDKE                                                        675
//

If you have problems or comments...

PBIL Back to PBIL home page