(data stored in ACNUC7421 zone)

EMBL: CP002160.PE355

CP002160.PE355       Location/Qualifiers
FT   CDS             complement(469717..470286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0366"
FT                   /product="Carbonate dehydratase"
FT                   /EC_number="4.2.1.1"
FT                   /note="KEGG: ckr:CKR_0471 hypothetical protein; PFAM:
FT                   carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50146"
FT                   /db_xref="GOA:D9SQ79"
FT                   /db_xref="InterPro:IPR001765"
FT                   /db_xref="InterPro:IPR036874"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ79"
FT                   /inference="protein motif:PRIAM:4.2.1.1"
FT                   /protein_id="ADL50146.1"
FT                   /translation="MNKLQEILDYNHHFVESKEYEKYATSKEPNKKLVILSCMDTRLTE
FT                   LLPKALNLKNGDVKLIKNAGASIMHPFGSIIRSIVVAVYEYNADEVLVIGHHGCGMSNL
FT                   NADKTIEKAKERGVSSEVLSTLSNAGIDVKGWLHGFNSVEESIKESVDLIKNHPLLPKD
FT                   IKVHGLIIDPSTGKLDVVINGYTENN"
     MNKLQEILDY NHHFVESKEY EKYATSKEPN KKLVILSCMD TRLTELLPKA LNLKNGDVKL        60
     IKNAGASIMH PFGSIIRSIV VAVYEYNADE VLVIGHHGCG MSNLNADKTI EKAKERGVSS       120
     EVLSTLSNAG IDVKGWLHGF NSVEESIKES VDLIKNHPLL PKDIKVHGLI IDPSTGKLDV       180
     VINGYTENN                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page