(data stored in ACNUC7421 zone)

EMBL: CP002160.PE356

CP002160.PE356       Location/Qualifiers
FT   CDS             470617..472563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0367"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="KEGG: cpf:CPF_1272 para-aminobenzoate synthase,
FT                   component I; TIGRFAM: para-aminobenzoate synthase, subunit
FT                   I; glutamine amidotransferase of anthranilate synthase;
FT                   PFAM: Chorismate binding-like; glutamine amidotransferase
FT                   class-I; Anthranilate synthase component I domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50147"
FT                   /db_xref="GOA:D9SQ80"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ80"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ADL50147.1"
FT                   /translation="MFLMIDNYDSFVYNLARYVQELGEEIVVIRNDKITIEEIFHLNPK
FT                   GIIISPGPKTPKEAGISLEVIDKFKGIKPILGVCLGFQCIGDYFGAKVKKGIYPIHGKL
FT                   SKTTHNQVGIFKGIKSPINVTRYHSLIVDKIDLPEELTITATSDDGVIMGLQHRYYDIY
FT                   GVQFHPEAALTEEGHNLLKNFIDICKKDLEPTVMDITIEEFQSYLNPCEIYSVFSKEKN
FT                   TIFLDSSKEDKELSRFSFIGVNPYKIYKTKGNKIYIDDKCYYGDPFLELEKLIKSMILD
FT                   NQYGNMDLPLLCGCIGYFSYDIGRIIEVIEDTSEKDFDSYDSYFVFYDNIIIFDLINDK
FT                   KYVTALGQSKDRKEAIAEIKEKILGAKGIKEEFQEKDQNTFYSNFTKEAYIDTIKKVKE
FT                   YIANGDVYITNLTQRFWCYNNKEGFQLYKDLRSINKAPFASYLNLDDIQVISSSPERFI
FT                   KIENNILETRPIKGTRPRGRNKEDDEKNRLELINSEKDKAELLMVTDLERNDLSKVCKV
FT                   NTVNVQGLFKLEEYSTVFHLVSTITGELMDNVSAVKAMRECFPGGSITGTPKIRSMEII
FT                   EELEKVRRNLYTGAIGYFDLRGNCDFNIVIRTIIKKDNKAYFGVGGGITIESDEEMEYE
FT                   ETLDKAKALMKVL"
     MFLMIDNYDS FVYNLARYVQ ELGEEIVVIR NDKITIEEIF HLNPKGIIIS PGPKTPKEAG        60
     ISLEVIDKFK GIKPILGVCL GFQCIGDYFG AKVKKGIYPI HGKLSKTTHN QVGIFKGIKS       120
     PINVTRYHSL IVDKIDLPEE LTITATSDDG VIMGLQHRYY DIYGVQFHPE AALTEEGHNL       180
     LKNFIDICKK DLEPTVMDIT IEEFQSYLNP CEIYSVFSKE KNTIFLDSSK EDKELSRFSF       240
     IGVNPYKIYK TKGNKIYIDD KCYYGDPFLE LEKLIKSMIL DNQYGNMDLP LLCGCIGYFS       300
     YDIGRIIEVI EDTSEKDFDS YDSYFVFYDN IIIFDLINDK KYVTALGQSK DRKEAIAEIK       360
     EKILGAKGIK EEFQEKDQNT FYSNFTKEAY IDTIKKVKEY IANGDVYITN LTQRFWCYNN       420
     KEGFQLYKDL RSINKAPFAS YLNLDDIQVI SSSPERFIKI ENNILETRPI KGTRPRGRNK       480
     EDDEKNRLEL INSEKDKAEL LMVTDLERND LSKVCKVNTV NVQGLFKLEE YSTVFHLVST       540
     ITGELMDNVS AVKAMRECFP GGSITGTPKI RSMEIIEELE KVRRNLYTGA IGYFDLRGNC       600
     DFNIVIRTII KKDNKAYFGV GGGITIESDE EMEYEETLDK AKALMKVL                    648
//

If you have problems or comments...

PBIL Back to PBIL home page