(data stored in ACNUC7421 zone)

EMBL: CP002160.PE359

CP002160.PE359       Location/Qualifiers
FT   CDS             474075..475274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0370"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: cac:CAC0505 cell
FT                   division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50150"
FT                   /db_xref="GOA:D9SQ83"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ83"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADL50150.1"
FT                   /translation="MDTYRDEKRLLRYTYLFIVVCSLNLFIIKDPLDFGALIMGAVMIV
FT                   LLAYTYFILRRFFPDGDKYIFIFSSMLTALGLVMIYRLDRGLAIKQIVWLILGIAIFIF
FT                   IVVLVPELKRFKKFKYIYMVLTLAFMAMATFIGTEIFGAKNWVYVGPISFQPSEFGKVF
FT                   LILYLAAALEEYENFKQLIEPAFIVMVSLGFMILQRDLGTALMIFAISLTMLYISTSKL
FT                   KYILTCLALFAIGATLSYFLFYHVRRRVLIWHDPWPYVGNESYQLVQGYYGIAMGGLFG
FT                   SGLGLGHPEFVAVRESDLIFSVIAEEMGMLVGFAVLILHFLLFYRNIRGAIYAKSNFTK
FT                   LLTVGLSTMIATQTLVIVGGVTGFIPLTGITLPLVSYGGTSLLITFISLGIIQKVSEGE
FT                   "
     MDTYRDEKRL LRYTYLFIVV CSLNLFIIKD PLDFGALIMG AVMIVLLAYT YFILRRFFPD        60
     GDKYIFIFSS MLTALGLVMI YRLDRGLAIK QIVWLILGIA IFIFIVVLVP ELKRFKKFKY       120
     IYMVLTLAFM AMATFIGTEI FGAKNWVYVG PISFQPSEFG KVFLILYLAA ALEEYENFKQ       180
     LIEPAFIVMV SLGFMILQRD LGTALMIFAI SLTMLYISTS KLKYILTCLA LFAIGATLSY       240
     FLFYHVRRRV LIWHDPWPYV GNESYQLVQG YYGIAMGGLF GSGLGLGHPE FVAVRESDLI       300
     FSVIAEEMGM LVGFAVLILH FLLFYRNIRG AIYAKSNFTK LLTVGLSTMI ATQTLVIVGG       360
     VTGFIPLTGI TLPLVSYGGT SLLITFISLG IIQKVSEGE                              399
//

If you have problems or comments...

PBIL Back to PBIL home page