(data stored in ACNUC7421 zone)

EMBL: CP002160.PE360

CP002160.PE360       Location/Qualifiers
FT   CDS             475277..476689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0371"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: cce:Ccel_2476 penicillin-binding protein
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50151"
FT                   /db_xref="GOA:D9SQ84"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ84"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ADL50151.1"
FT                   /translation="MKDITNNVKKVMIVYLIIFISLISYITYFILFTGPKIEDRSDNQR
FT                   LWAQRNEVLRGTIYDKNMTPLSQSTRNSEGNQVRTYNGGAYTAHALGFEDARYGITGLE
FT                   NKYDSYLMKDNHSKIIDSILSGEKRKEKIGESVVTTLDINLQKKAYEALGNNKGSIVVL
FT                   DVKTGGILAMVSKPSYDPNDLEAQWEGLQSSENRPLLNRSVSGLYPPGSTFKVITSLSA
FT                   IENLQGITEEIFNDDGALEIGGGYSLKNDSGEVLGKINLEEALAYSSNVVFGDIGIRLG
FT                   NKKLRDTAEALYFNNDTPADGIVIDNSIFPKYSDNEEGNIAQSAIGQAGVLASPIQMAL
FT                   VAATIAHGGEMMEPHMVSRIIDKDSKLVEEIKPKSLGQKVPTNAANLVRSYMRSVVTGG
FT                   TGVNVSSKNVQVAGKTGTADNETGSPHSWFIGFAPYDNPEIAIAVVAEGAGYGAQVAVP
FT                   AASKVINQYFSK"
     MKDITNNVKK VMIVYLIIFI SLISYITYFI LFTGPKIEDR SDNQRLWAQR NEVLRGTIYD        60
     KNMTPLSQST RNSEGNQVRT YNGGAYTAHA LGFEDARYGI TGLENKYDSY LMKDNHSKII       120
     DSILSGEKRK EKIGESVVTT LDINLQKKAY EALGNNKGSI VVLDVKTGGI LAMVSKPSYD       180
     PNDLEAQWEG LQSSENRPLL NRSVSGLYPP GSTFKVITSL SAIENLQGIT EEIFNDDGAL       240
     EIGGGYSLKN DSGEVLGKIN LEEALAYSSN VVFGDIGIRL GNKKLRDTAE ALYFNNDTPA       300
     DGIVIDNSIF PKYSDNEEGN IAQSAIGQAG VLASPIQMAL VAATIAHGGE MMEPHMVSRI       360
     IDKDSKLVEE IKPKSLGQKV PTNAANLVRS YMRSVVTGGT GVNVSSKNVQ VAGKTGTADN       420
     ETGSPHSWFI GFAPYDNPEI AIAVVAEGAG YGAQVAVPAA SKVINQYFSK                  470
//

If you have problems or comments...

PBIL Back to PBIL home page