(data stored in ACNUC7421 zone)

EMBL: CP002160.PE364

CP002160.PE364       Location/Qualifiers
FT   CDS             480722..481606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ckr:CKR_3143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50155"
FT                   /db_xref="GOA:D9SQ88"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ88"
FT                   /inference="similar to AA sequence:KEGG:CKR_3143"
FT                   /protein_id="ADL50155.1"
FT                   /translation="MRFVIVTGLSGAGKTQAIRSLEDLGYFCVDNLPPTLIPKFAEACY
FT                   QTEGKIDRIALVIDIRGRKFFDDLFESLNYLKSKQYRYEILFLDASDEVLIKRYKETRR
FT                   KHPLAQQGRIIDGITLERAKLKELRDRADNIIDTTKLATRELREKIERIYQEEGQIEAQ
FT                   LSITILSFGFKYGIPVDSDLVVDVRFLPNPFYIPELKAFSGNDKQIQDYVFSFKETQDF
FT                   LDKYTDMLNFLIPYYFQEGKRQLIVSIGCTGGRHRSVAIANEIYNRLFAAGGRVTLEHR
FT                   DINEDVRGGGNKL"
     MRFVIVTGLS GAGKTQAIRS LEDLGYFCVD NLPPTLIPKF AEACYQTEGK IDRIALVIDI        60
     RGRKFFDDLF ESLNYLKSKQ YRYEILFLDA SDEVLIKRYK ETRRKHPLAQ QGRIIDGITL       120
     ERAKLKELRD RADNIIDTTK LATRELREKI ERIYQEEGQI EAQLSITILS FGFKYGIPVD       180
     SDLVVDVRFL PNPFYIPELK AFSGNDKQIQ DYVFSFKETQ DFLDKYTDML NFLIPYYFQE       240
     GKRQLIVSIG CTGGRHRSVA IANEIYNRLF AAGGRVTLEH RDINEDVRGG GNKL             294
//

If you have problems or comments...

PBIL Back to PBIL home page