(data stored in ACNUC7421 zone)

EMBL: CP002160.PE365

CP002160.PE365       Location/Qualifiers
FT   CDS             481603..482946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0376"
FT                   /product="protein of unknown function UPF0052 and CofD"
FT                   /note="PFAM: protein of unknown function UPF0052 and CofD;
FT                   KEGG: cac:CAC0512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50156"
FT                   /db_xref="GOA:D9SQ89"
FT                   /db_xref="InterPro:IPR002882"
FT                   /db_xref="InterPro:IPR010119"
FT                   /db_xref="InterPro:IPR038136"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ89"
FT                   /inference="protein motif:PFAM:PF01933"
FT                   /protein_id="ADL50156.1"
FT                   /translation="MKFLDWFRPGIKVKRWVFLASMGILFIAFGIAEIALRFRYYNGYY
FT                   RAFYVFIIVSGIFVVYLSVMQGMKSIIALINTGYLQVSINSRKLGNLIYEKRLLVKGPK
FT                   IVAIGGGTGLSTMLRGLKYYTSNITAIVTVADDGGGSGDLREDLGILPPGDIRNCILAL
FT                   SDTEPLMEELLQYRFKDGRLKNQSFGNLFLAAMDGISVNFEEAVQKMSSVLAVVGKVVP
FT                   VTLENMVLKAELENGDIVEGESNIPYEAFKNKNPIKRVFIEPEDAKAVQEAIDAINEAD
FT                   AIILGPGSLYTSVLPNLLIKDISEALKKTDALRIYISNIMTQPGETDGYDVADHIEAIN
FT                   RHVKGKIVDLTIVNQQGISKELLEKYLDDASEFVDLNEKKIKQMGIDVVKGNLVATSSN
FT                   GHVRHNSEELAAIIVETIMDRKLFFDRKKIIEYFYLSERLKETKNIDS"
     MKFLDWFRPG IKVKRWVFLA SMGILFIAFG IAEIALRFRY YNGYYRAFYV FIIVSGIFVV        60
     YLSVMQGMKS IIALINTGYL QVSINSRKLG NLIYEKRLLV KGPKIVAIGG GTGLSTMLRG       120
     LKYYTSNITA IVTVADDGGG SGDLREDLGI LPPGDIRNCI LALSDTEPLM EELLQYRFKD       180
     GRLKNQSFGN LFLAAMDGIS VNFEEAVQKM SSVLAVVGKV VPVTLENMVL KAELENGDIV       240
     EGESNIPYEA FKNKNPIKRV FIEPEDAKAV QEAIDAINEA DAIILGPGSL YTSVLPNLLI       300
     KDISEALKKT DALRIYISNI MTQPGETDGY DVADHIEAIN RHVKGKIVDL TIVNQQGISK       360
     ELLEKYLDDA SEFVDLNEKK IKQMGIDVVK GNLVATSSNG HVRHNSEELA AIIVETIMDR       420
     KLFFDRKKII EYFYLSERLK ETKNIDS                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page