(data stored in ACNUC7421 zone)

EMBL: CP002160.PE368

CP002160.PE368       Location/Qualifiers
FT   CDS             complement(485207..485752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0379"
FT                   /product="Rubrerythrin"
FT                   /note="PFAM: Rubrerythrin; KEGG: cdl:CDR20291_1373 putative
FT                   rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50159"
FT                   /db_xref="GOA:D9SQ92"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQ92"
FT                   /inference="protein motif:PFAM:PF02915"
FT                   /protein_id="ADL50159.1"
FT                   /translation="MKKFICTVCGYIHEGDAAPELCPVCKAPAAKFQEQTGERVWADEH
FT                   RIGVAKGVEQDVLDDLRANFMGECTEVGMYLAMSRQADREGFPEVAEAYKRIAFEEAEH
FT                   ASKFAELLGEVVVADTKANLQARVDAEYGATDGKKKLATRAKELGYDAIHDTVHEMCKD
FT                   EARHGKAFLGLLNRYFNK"
     MKKFICTVCG YIHEGDAAPE LCPVCKAPAA KFQEQTGERV WADEHRIGVA KGVEQDVLDD        60
     LRANFMGECT EVGMYLAMSR QADREGFPEV AEAYKRIAFE EAEHASKFAE LLGEVVVADT       120
     KANLQARVDA EYGATDGKKK LATRAKELGY DAIHDTVHEM CKDEARHGKA FLGLLNRYFN       180
     K                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page